SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024348 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024348
Domain Number 1 Region: 418-550
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.5e-32
Family DEP domain 0.0000226
Further Details:      
 
Domain Number 2 Region: 12-91
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.41e-24
Family DIX domain 0.0019
Further Details:      
 
Domain Number 3 Region: 244-356
Classification Level Classification E-value
Superfamily PDZ domain-like 1.73e-23
Family PDZ domain 0.0000261
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024348   Gene: ENSRNOG00000017915   Transcript: ENSRNOT00000024348
Sequence length 736
Comment pep:known chromosome:RGSC3.4:10:56846963:56855641:1 gene:ENSRNOG00000017915 transcript:ENSRNOT00000024348 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSSAGGGGVGETKVIYHLDEEETPYLVKIPVPAERITLGDFKSVLQRPAGAKYFFKSM
DQDFGVVKEEISDDSARLPCFNGRVVSWLVSSESPQPETAPPAHESRTELVPPPPPLPPL
PPERTSGIGDSRPPSFHPNVSSSHENLEPETETESVVSLRRDRPRRRDSSEHGAGGHRPG
VPSRLERHLAGYESSSTLMTSELESTSLGDSDEDDSMSRFSSSTEQSSASRLLKRHRRRR
KQRPPRMERTSSFSSVTDSTMSLNIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIM
KGGAVAADGRIEPGDMLLQVNDMNFENMSNDDAVRVLRDIVHKPGPIVLTVAKCWDPSPQ
AYFTLPRNEPIQPIDPAAWVSHSAALTGAFPAYPGSSSMSTITSGSSLPDGCEGRGLSVH
MDMASVTKAMAAPESGLEVRDRMWLKITIPNAFLGSDVVDWLYHHVEGFPERREARKYAS
GLLKAGLIRHTVNKITFSEQCYYVFGDLSGGCESYLVNLSLNDNDGSSGASDQDTLAPLP
GATPWPLLPTFSYQYPAPHPYSPQPPPYHELSSYSYGGGSASSQHSEGNRSSGSTRSDGG
AGRTGRPEERAPESKSGSGSESELSSRGGSLRRGGEPGGTGDGGPPPSRGSAGGTPNLRA
LPGLHPYGPPPGMALPYNPMMVVMMPPPPPPVSTAVQPPGAPPVRDLGSVPPELTASRQS
FHMAMGNPSEFFVDVM
Download sequence
Identical sequences ENSRNOP00000024348 10116.ENSRNOP00000024348

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]