SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024408 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024408
Domain Number 1 Region: 94-180
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000799
Family HtrA-like serine proteases 0.072
Further Details:      
 
Domain Number 2 Region: 12-76
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000213
Family HtrA-like serine proteases 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024408   Gene: ENSRNOG00000018047   Transcript: ENSRNOT00000024408
Sequence length 446
Comment pep:known chromosome:RGSC3.4:8:124883446:124895149:-1 gene:ENSRNOG00000018047 transcript:ENSRNOT00000024408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLGASSEQPAGGEGFHLHGVQENSPAQQAGLEPYFDFIITIGHSRLNKENDTLKALLKA
NVEKPVKLEVFNMKTMRVREVEVVPSNMWGGQGLLGASVRFCSFRRASEHVWHVLDVEPS
SPAALAGLRPYTDYIVGSDQILQESEDFFTLIESHEGKPLKLMVYNSESDSCREVTVTPN
AAWGGEGSLGCGIGYGYLHRIPTQPSSQYKKPPSASSPGTPAKTPQPNAFPLGAPPPWPI
PQDSSGPELGSRQSDYMEALPQVPGGFMEEQLPGPGSPGHGTADYGGCLHSMEIPLQPPP
PVQRVMDPGFLDVSGMSLLDSSNTSVCPSLSSSSLLTPTAVSALGPEDIGSSSSSHERGG
EATWSGSEFEISFPDSPGSQAQVDHLPRLTLPDGLTSAASPEEGLSAELLEAQTEEPADT
ASLDCMAETEGPAGQVQAAPDPEPGL
Download sequence
Identical sequences B1WBR1
NP_062258.2.100692 NP_062258.2.4139 ENSRNOP00000024408 ENSRNOP00000024408 10116.ENSRNOP00000024408

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]