SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024418 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024418
Domain Number 1 Region: 1-77
Classification Level Classification E-value
Superfamily SAM/Pointed domain 8.43e-18
Family SAM (sterile alpha motif) domain 0.0026
Further Details:      
 
Domain Number 2 Region: 208-294
Classification Level Classification E-value
Superfamily PDZ domain-like 4.47e-16
Family PDZ domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024418   Gene: ENSRNOG00000018052   Transcript: ENSRNOT00000024418
Sequence length 555
Comment pep:known chromosome:RGSC3.4:1:37865904:37958862:-1 gene:ENSRNOG00000018052 transcript:ENSRNOT00000024418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPVTKWSPKQVVDWTRGLDDCLQPYVHKFEREKIDGEQLLKISHQDLEELGVTRIGHQE
LVLEAVDLLCALNYGLETDNMKNLVLKLRASSHNLQNYISSRRKSPAYDGNTSRKPPNEF
LTSVVELIGAAKALLAWLDRAPFTGITDLSVTKNKIIQLCLDLTTAVQKDCLVAEMEDKV
LNVVKVLNGICDKMMHSTTDPVMSQCACLEEVHLPNVRPGEGLGMYIKSTYDGLHVITGT
TENSPADRSQKIHAGDEVIQVNRQTVVGWQLKNLVKKLRENPTGVVLLLKKRPTGSFSFT
PAPLKNLRWKPPLVQTSPPPTTTQSPESTMDASLKKEKPAILDLYIPPPPAVPYSPRDEN
VSFSYRGHTKSKQPLPGRKGSESPNSFLDQESQRRRFTITDSDQLPGYSVGTNILPIKMR
GKTPSYGKPRPLSMPADGNWMGIVDPFAKPRGHGRKGEDALCRYFSNERITPIIEESASP
VYRFSRPLTERHLVRGADYIRGSRCYINSDLHSSATIPFQEEGPKKKSASSSAKASSGEP
SLLVSWLTRLKLLTH
Download sequence
Identical sequences Q5SGD7
ENSRNOP00000024418 NP_001012061.1.100692 NP_001012061.1.4139 10116.ENSRNOP00000024418 ENSRNOP00000024418

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]