SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024517 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024517
Domain Number 1 Region: 37-273
Classification Level Classification E-value
Superfamily Nqo1 FMN-binding domain-like 2.22e-85
Family Nqo1 FMN-binding domain-like 0.000000351
Further Details:      
 
Domain Number 2 Region: 360-452
Classification Level Classification E-value
Superfamily Nqo1C-terminal domain-like 3.14e-35
Family Nqo1C-terminal domain-like 0.0002
Further Details:      
 
Domain Number 3 Region: 274-358
Classification Level Classification E-value
Superfamily Nqo1 middle domain-like 4.32e-22
Family Nqo1 middle domain-like 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024517   Gene: ENSRNOG00000018117   Transcript: ENSRNOT00000024517
Sequence length 464
Comment pep:known chromosome:RGSC3.4:1:206590025:206595056:-1 gene:ENSRNOG00000018117 transcript:ENSRNOT00000024517 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLAARHFLGGSVPVRVSVRLSSGTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQRRG
DWYKTKEILLKGPDWILGEMKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIMRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACDSDYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGTWFAGFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVLGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMNSS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEDRMQRFAQQHQARQAAS
Download sequence
Identical sequences Q5XIH3
ENSRNOP00000024517 10116.ENSRNOP00000024517 ENSRNOP00000024517 NP_001006973.1.100692 NP_001006973.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]