SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024583 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024583
Domain Number 1 Region: 135-208
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 5.63e-31
Family AN1-like Zinc finger 0.0000169
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000000185
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024583   Gene: ENSRNOG00000018107   Transcript: ENSRNOT00000024583
Sequence length 213
Comment pep:known chromosome:RGSC3.4:1:224439197:224448426:1 gene:ENSRNOG00000018107 transcript:ENSRNOT00000024583 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQETNQTPGPMLCSTGCGFYGNPRTNGMCSVCYKEHLQRQQNSGRMSPMGTASGSNSPT
SDSASVQRADATLNNCEGAAGSTSEKSRNVPVAALPVTQQMTEMSISREDKITSPKTEVS
EPVVTQPSPSVSQPSSSQSEEKAPELPKPKKNRCFMCRKKVGLTGFDCRCGNLFCGLHRY
SDKHNCPYDYKAEAAAKIRKENPVVVAEKIQRI
Download sequence
Identical sequences B5DF11
XP_008758519.1.100692 10116.ENSRNOP00000024583 ENSRNOP00000024583 ENSRNOP00000024583

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]