SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000024999 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000024999
Domain Number 1 Region: 190-532
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.25e-81
Family Protein kinases, catalytic subunit 0.00000238
Further Details:      
 
Domain Number 2 Region: 38-185
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.77e-38
Family Regulator of G-protein signaling, RGS 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000024999   Gene: ENSRNOG00000018430   Transcript: ENSRNOT00000024999
Sequence length 564
Comment pep:known chromosome:RGSC3.4:16:80979331:80991796:-1 gene:ENSRNOG00000018430 transcript:ENSRNOT00000024999 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDFGSLETVVANSAFIAARGSFDGSSTPSSRDKKYLAKLRLPPLSKCEGLRDSISLEFDN
LCSEQPIGKRLFQQFLKTDERHVPALELWKDIEDYDTADDDLRPQKAQAILAEYLDPQGT
LFCNFLDQGMVARVKEGPTGSQDGLFQPLLQATLEHLSQGPFQEYLGSLYFLRFLQWKWL
EAQPIGEDWFLDFRVLGKGGFGEVSACQMKATGKMYACKKLNKKRLKKRKGYQGAIVEKR
ILAKVHSRFIVSLAYAFETKTDLCLVMTIMNGGDVRYHIYNVDEENPGFPEPRAIYYTAQ
IISGLEHLHQRRIVYRDLKPENVLLDNDGNIRISDLGLAVELKEGQNKTKGYAGTPGFMA
PELLRGEEYDFSVDYFALGVTLYEMIAARGPFRARGEKVENKELKQRIISEPVKYPEKFS
QASKDFCEQLLEKDPEKRLGFRDGTCDALRANVLFKDISWRQLEAGMLIPPFIPDSRTVY
AKNIQDVGAFSTVKGVVFDKADTEFFQEFASGNCSIPWQEEMIETGVFGDLNVWRPDGQM
PDDMKGITVEEAAPTAKSGMCLIS
Download sequence
Identical sequences G3V8E1
10116.ENSRNOP00000024999 ENSRNOP00000024999 ENSRNOP00000024999

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]