SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025386 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000025386
Domain Number - Region: 63-107
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 0.0561
Family Putative zinc binding domain 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025386   Gene: ENSRNOG00000018791   Transcript: ENSRNOT00000025386
Sequence length 173
Comment pep:known chromosome:RGSC3.4:3:4522916:4524662:-1 gene:ENSRNOG00000018791 transcript:ENSRNOT00000025386 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRTALSRMPTLLRSVRTRDSGPRQLWDLGARLKTAKRLRGWAWGWRSSSSAPGSEHAAA
LGRVKADHYQLVYTCKVCGTRSSKHISKLAYHQGVVIVTCPGCQNHHIIADNLSWFSDLK
GKRNIEEILAARGEEVRRVCGDGALELILEVAEPPATPEGGEDPTHPGKMDQS
Download sequence
Identical sequences D3ZWJ1
NP_001124462.1.100692 NP_001124462.1.4139 ENSRNOP00000025386 10116.ENSRNOP00000025386 ENSRNOP00000025386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]