SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025716 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025716
Domain Number 1 Region: 180-223
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000022
Family RING finger domain, C3HC4 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025716   Gene: ENSRNOG00000019028   Transcript: ENSRNOT00000025716
Sequence length 227
Comment pep:known chromosome:RGSC3.4:19:41455386:41539353:1 gene:ENSRNOG00000019028 transcript:ENSRNOT00000025716 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGKQSTAARSRGPFPGVSTDDSAVPPPGGAPHFGHYRTGGGAMGLRSRSVSSVAGMGMD
PSTTGGVPFSLYTPASRGTGDSERAPGGGGSTSDSTYAHGNGYQETGGGHHRDGMLYLGS
RASLADALPLHIAPRWFSSHSGFKCPICSKSVASDEMEMHFIMCLSKPRLSYNDDVLTKD
AGECVICLEELLQGDTIARLPCLCIYHKSCIDSWFEVNRSCPEHPAD
Download sequence
Identical sequences D3ZIQ9
ENSRNOP00000025716 XP_002725463.1.4139 XP_003751930.1.100692 XP_006222813.1.4139 XP_006255715.1.100692 ENSRNOP00000025716 10116.ENSRNOP00000025716

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]