SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025847 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025847
Domain Number 1 Region: 149-494
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.1e-86
Family Protein kinases, catalytic subunit 0.00000000000288
Further Details:      
 
Domain Number 2 Region: 2-146
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.47e-38
Family Regulator of G-protein signaling, RGS 0.0000000866
Further Details:      
 
Domain Number 3 Region: 516-626
Classification Level Classification E-value
Superfamily PH domain-like 8.77e-27
Family Pleckstrin-homology domain (PH domain) 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025847   Gene: ENSRNOG00000018985   Transcript: ENSRNOT00000025847
Sequence length 651
Comment pep:known chromosome:RGSC3.4:1:206873002:206892867:-1 gene:ENSRNOG00000018985 transcript:ENSRNOT00000025847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IRSVMQKYLEDRGEVTFEKIFSQKLGYLLFRDFCLNHLEEAKPLVEFYEEIKKYEKLETE
EERVVRSREIFDSYIMKELLACSHPFSKNATEHVQGHLVKKQVPPDLFQPYIEEICQNLR
GDVFHKFIESDKFTRFCQWKNVELNIHLTMNDFSVHRIIGRGGFGEVYGCRKADTGKMYA
MKCLDKKRIKMKQGETLALNERIMLSLVSTGDCPFIVCMSYAFHTPDKLSFILDLMNGGD
LHYHLSQHGVFSEADMRFYAAEIILGLEHMHNRFVVYRDLKPANILLDEHGHVRISDLGL
ACDFSKKKPHASVGTHGYMAPEVLQKGVAYDSSADWFSLGCMLFKLLRGHSPFRQHKTKD
KHEIDRMTLTMAVELPDSFSPELRSLLEGLLQRDVNRRLGCLGRGAQEVKESPFFRSLDW
QMVFLQKYPPPLIPPRGEVNAADAFDIGSFDEEDTKGIKLLDSDQELYRNFPLTISERWQ
QEVAETVFDTINAETDRLEARKKAKNKQLGHEEDYALGKDCIMHGYMSKMGNPFLTQWQR
RYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEETQIKERKCLLLKIRGGKQFVLQCDSDP
ELVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLIQRGSANGL
Download sequence
Identical sequences 10116.ENSRNOP00000025847 ENSRNOP00000025847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]