SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000025949 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000025949
Domain Number 1 Region: 182-327
Classification Level Classification E-value
Superfamily C-type lectin-like 7e-26
Family C-type lectin domain 0.00027
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000025949
Domain Number - Region: 108-143
Classification Level Classification E-value
Superfamily Cryptochrome/photolyase, N-terminal domain 0.0409
Family Cryptochrome/photolyase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000025949   Gene: ENSRNOG00000019138   Transcript: ENSRNOT00000025949
Sequence length 328
Comment pep:known chromosome:RGSC3.4:1:94785183:94788320:-1 gene:ENSRNOG00000019138 transcript:ENSRNOT00000025949 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQAAWLLGALLVPHLLSFGHGARGHGKEWEGVWGGALEEERDRESLMLKNLQEALGLPTG
VGNKDNLAENSEGKEVWEATETQGEEEEEETTTTPSSSPTPFPSPSPTSEDTVTYILGRL
ASLDAGLHQLHIRLHVLDTRVVELTQGLRRLRDAASDTRDSVQALKEVQVRSEQEHGRLE
GCLKGLRLGHKCFLLSRDFETQAAAQARCKARGGSLAQPADRQQMDALSRYLRAALAPYN
WPVWLGVHDRRSEGLYLFENGQRVSFFAWHRALSPESGAQPSAASHPLSPDQPNGGILEN
CVAQASDDGSWWDHDCERRLYFVCEFPF
Download sequence
Identical sequences O88201
10116.ENSRNOP00000025949 NP_001012477.1.100692 NP_001012477.1.4139 ENSRNOP00000025949 ENSRNOP00000025949

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]