SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026032 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026032
Domain Number 1 Region: 305-597
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.83e-70
Family Protein kinases, catalytic subunit 0.00013
Further Details:      
 
Domain Number 2 Region: 39-102
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000123
Family LIM domain 0.00063
Further Details:      
 
Domain Number 3 Region: 96-128
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.000000000242
Family LIM domain 0.00073
Further Details:      
 
Domain Number 4 Region: 150-244
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000025
Family PDZ domain 0.021
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000026032
Domain Number - Region: 9-43
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00483
Family LIM domain 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026032   Gene: ENSRNOG00000019000   Transcript: ENSRNOT00000026032
Sequence length 638
Comment pep:known chromosome:RGSC3.4:14:83969282:84037218:-1 gene:ENSRNOG00000019000 transcript:ENSRNOT00000026032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALAGEEAWRCRGCGNYVPLSQRLYRTANEAWHSSCFRCSECQESLTNWYYEKDGKLYC
HKDYWAKFGEFCHGCSLLMTGPAMVAGEFKYHPECFACMSCKVIIEDGDAYALVQHATLY
CGKCHNEVVLAPMFERLSTESVQDQLPYSVTLISMPATTECRRGFSVSVESASSNYATTV
QVKEVNRMHISPNNRNAIHPGDRILEINGTPVRTLRVEEVEDAINQTSQTLQLLIEHDPV
PQRLDQLRLDTRLSPHMQSSGHTLMLSTLDAKENQEGTLRRRSLRRSNSISKSPGPSSPK
EPLLLSRDISRSESLRCSSSYSQQIFRPCDLIHGEVLGKGFFGQAIKVTHKATGKVMVMK
ELIRCDEETQKTFLTEVKVMRSLDHPNVLKFIGVLYKDKKLNLLTEYIEGGTLKDFLRNV
DPFPWQQKVRFAKGIASGMAYLHSMCIIHRDLNSHNCLIKLDKTVVVADFGLSRLIVEER
KRPPVEKAATKKRTLRKSDRKKRYTVVGNPYWMAPEMLNGKSYDETVDVFSFGIVLCEII
GQVYADPDCLPRTLDFGLNVKLFWEKFVPTDCPPAFFPLAAICCKLEPESRPAFSKLEDS
FEALSLFLGELAIPLPAELEELDHTVSMEYGLTRDSPP
Download sequence
Identical sequences P53670
NP_077049.2.100692 NP_077049.2.4139 ENSRNOP00000026032 10116.ENSRNOP00000026032 ENSRNOP00000026032

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]