SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026120 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026120
Domain Number 1 Region: 31-480
Classification Level Classification E-value
Superfamily Seven-hairpin glycosidases 9.03e-150
Family Class I alpha-1;2-mannosidase, catalytic domain 0.0000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026120   Gene: ENSRNOG00000019299   Transcript: ENSRNOT00000026120
Sequence length 576
Comment pep:known chromosome:RGSC3.4:3:146215244:146241062:-1 gene:ENSRNOG00000019299 transcript:ENSRNOT00000026120 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPFRLLIPLGLVCVLLPLHHGAPGPEGTAPDPAHYRERVKAMFYHAYDSYLENAFPYDEL
RPLTCDGHDTWGSFSLTLIDALDTLLILGNTSEFQRVVEVLQDNVDFDIDVNASVFETNI
RVVGGLLSAHLLSKKAGVEVEAGWPCSGPLLRMAEEAARKLLPAFQTPTGMPYGTVNLLH
GVNPGETPVTCTAGIGTFIVEFATLSSLTGDPVFEDVARVALMRLWESRSDIGLVGNHID
VLTGKWVAQDAGIGAGVDSYFEYLVKGAILLQDKKLMAMFLEYNKAIRNYTHFDDWYLWV
QMYKGTVSMPVFQSLEAYWPGLQSLIGDIDNAMRTFLNYYTVWKQFGGLPEFYNIPQGYT
VEKREGYPLRPELIESAMYLYRATGDPTLLELGRDAVESIEKISKVECGFATIKDLRDHK
LDNRMESFFLAETVKYLYLLFHPNNFIHNNGSTFDSVMTPHGECILGAGGYIFNTEAHPI
DPAALHCCRRLKEEQWEVEDLIKEFYSLRQSRSRAQRKTVSSGPWEPPAGPGTLSSPENQ
PREKQPARQRAPLLSCPSQPFTSKLALLGQVFLDSS
Download sequence
Identical sequences Q6AYI8
ENSRNOP00000026120 10116.ENSRNOP00000026120 ENSRNOP00000026120 NP_001004230.1.100692 NP_001004230.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]