SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026311 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026311
Domain Number 1 Region: 15-114
Classification Level Classification E-value
Superfamily PDZ domain-like 1.55e-21
Family SCOPe 0.0000422
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026311   Gene: ENSRNOG00000019357   Transcript: ENSRNOT00000026310
Sequence length 124
Comment pep:known chromosome:RGSC3.4:10:60054096:60058594:1 gene:ENSRNOG00000019357 transcript:ENSRNOT00000026310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRV
SEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQ
SMLS
Download sequence
Identical sequences A0A091DC29 A0A096P2E5 A0A1A6GS91 A0A1S3EZD4 A0A1U7QA00 A0A1U7TFX6 A0A1W2Q5Z6 A0A250Y9F9 A0A286XD20 A0A287D2C6 A0A2I2U8E9 A0A2K5IMU6 A0A2K5LAZ0 A0A2K5PD69 A0A2K6BA75 A0A2K6GWJ2 A0A2K6LWF3 A0A2K6R5C2 A0A2K6SUB2 E2R7R0 F2Z516 F6WIC5 F7E3I9 G1U4H9 G3R350 G3TML9 G5B935 H2NS97 I7GLD5 K7C2Z3 L5JYX8 L5M109 O14907 S9XQ10 U3FIY1
ENSOCUP00000024303 10116.ENSRNOP00000026311 10141.ENSCPOP00000014794 9544.ENSMMUP00000030793 9600.ENSPPYP00000008804 9606.ENSP00000225525 9615.ENSCAFP00000030824 9685.ENSFCAP00000015072 9796.ENSECAP00000021913 9823.ENSSSCP00000018925 9986.ENSOCUP00000024303 ENSFCAP00000022183 gi|11993943|ref|NP_055419.1| ENSCPOP00000014794 ENSMMUP00000030793 ENSPPYP00000008804 ENSFCAP00000015072 ENSPANP00000019520 ENSCAFP00000028582 ENSECAP00000021913 ENSPVAP00000012015 000416476|e2l4sA1|7.1.1.2|A:1-124 000416477|e2l4tA1|7.1.1.2|A:1-124 cath|current|2l4tA00/1-124 cath|current|3gj9A00/10-117 cath|current|3gj9B00/11-116 d2l4sa_ d2l4ta_ ENSP00000225525 ENSCAFP00000028582 ENSRNOP00000026311 ENSPCAP00000011296 ENSSSCP00000018925 ENSOCUP00000024303 ENSP00000225525 HGL_H00000225525 ENSECAP00000021913 ENSP00000225525 ENSPPYP00000008804 ENSLAFP00000016369 ENSMMUP00000030793 ENSPVAP00000012015 ENSSSCP00000018925 ENSLAFP00000016369 ENSCPOP00000014794 ENSSTOP00000017212 ENSSTOP00000017212 ENSDORP00000012976 NP_001244463.1.72884 NP_001272005.1.63531 NP_055419.1.87134 NP_055419.1.92137 XP_001504777.1.31192 XP_002718911.1.1745 XP_002826897.1.23681 XP_003131896.1.46622 XP_003416888.1.64505 XP_003469703.1.53824 XP_003639313.1.84170 XP_003810276.1.60992 XP_003933114.1.74449 XP_003996436.1.62641 XP_004058338.1.27298 XP_004376187.1.4749 XP_004416027.1.74151 XP_004433326.1.5094 XP_004605016.1.94378 XP_004638341.1.9945 XP_004672449.1.11716 XP_004684821.1.23501 XP_004716217.1.18182 XP_004857275.1.39548 XP_005067487.1.91757 XP_005337359.1.77405 XP_005399780.1.28644 XP_006105197.1.53796 XP_006167654.1.99106 XP_006172595.1.101512 XP_006213399.1.17985 XP_006246823.1.100692 XP_006746447.1.47382 XP_006761550.1.95426 XP_006863330.1.41390 XP_006899810.1.29581 XP_006922264.1.64745 XP_007076218.1.5354 XP_007615299.1.28591 XP_007647966.1.69978 XP_007935670.1.48129 XP_008008067.1.81039 XP_008058939.1.4292 XP_008154985.1.99482 XP_008536318.1.77740 XP_008567041.1.73410 XP_008853839.1.79516 XP_010380503.1.97406 XP_010609682.1.5607 XP_010948541.1.22495 XP_010986235.1.51371 XP_011358109.1.92234 XP_011723178.1.29376 XP_011802862.1.43180 XP_011911331.1.92194 XP_012508069.1.63892 XP_012508070.1.63892 XP_012634774.1.48125 XP_012868802.1.60039 XP_014688047.1.49734 XP_015292874.1.63531 XP_015361420.1.40921 XP_015994346.1.101085 XP_016056421.1.3490 XP_016786707.1.37143 XP_017367692.1.71028 XP_017508723.1.32401 XP_017719090.1.44346 XP_017827712.1.60252 XP_019285091.1.44245 XP_019599401.1.88060 XP_020032004.1.5219 XP_021559738.1.83697 ENSPCAP00000011296 ENSDORP00000012976 2l4s_A 2l4t_A 3gj9_A 3gj9_B

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]