SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026414 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSRNOP00000026414
Domain Number - Region: 292-359
Classification Level Classification E-value
Superfamily MAPEG domain-like 0.00373
Family MAPEG domain 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026414   Gene: ENSRNOG00000019414   Transcript: ENSRNOT00000026414
Sequence length 391
Comment pep:known chromosome:RGSC3.4:2:180442064:180446842:-1 gene:ENSRNOG00000019414 transcript:ENSRNOT00000026414 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTEPETLALLDMKDTEISEKSPPQASVLQPEEEGGTESPGAESLRVGSSVGSPTVREGPE
DGPDSTISEAATLPWGTDPHPSAPLPDPPGWRDIGPELLESEAPIKSEEPLKEDANLLPE
KTVRAFVPIDLQCIERKPQEERIKHREAGPGELRNFLPARLSHPEPPERKWAEAVVRPPG
RSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFDAPRLPTMSSRLVYTLRCG
VFATFPIVLGLLVYGLSLLCFSALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLAVLST
YLPQDTLKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYGLTFLPLLAMLVWNLYYMFVV
EPERMLSASESRLDYPDHVRSVSDYRPRSWG
Download sequence
Identical sequences Q3T1H8
ENSRNOP00000026414 10116.ENSRNOP00000026414 ENSRNOP00000026414 NP_001029068.1.100692 NP_001029068.1.4139 XP_006232699.1.100692 XP_008759371.1.100692 XP_017446369.1.100692 XP_017446370.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]