SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026439 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026439
Domain Number 1 Region: 408-541
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2.72e-34
Family DEP domain 0.00000575
Further Details:      
 
Domain Number 2 Region: 2-82
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.78e-24
Family DIX domain 0.0029
Further Details:      
 
Domain Number 3 Region: 234-345
Classification Level Classification E-value
Superfamily PDZ domain-like 7.59e-23
Family PDZ domain 0.000021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026439   Gene: ENSRNOG00000019423   Transcript: ENSRNOT00000026439
Sequence length 695
Comment pep:known chromosome:RGSC3.4:5:172705951:172717626:1 gene:ENSRNOG00000019423 transcript:ENSRNOT00000026439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAETKIIYHMDEEETPYLVKLPVAPERVTLADFKNVLSNRPVHAYKFFFKSMDQDFGVVK
EEIFDDNAKLPCFNGRVVSWLVLAEGAHSDAGSQGTDSHTDLPPPLERTGGIGDSRPPSF
HPNVASSRDGMDNETGTESMVSHRRERARRRNRDEAARTNGHPRGDRRRELGLPPDSAST
VLSSELESSSFIDSDEEDNTSRLSSSTEQSTSSRLIRKHKCRRRKQRLRQTDRASSFSSI
TDSTMSLNIITVTLNMERHHFLGISIVGQSNDRGDGGIYIGSIMKGGAVAADGRIEPGDM
LLQVNDVNFENMSNDDAVRVLREIVSQTGPISLTVAKCWDPTPRSYFTIPRADPVRPIDP
AAWLSHTAALTGALPRYGTSPCSSAITRTSSSSLTSSVPGAPQLEEAPLTVKSDMSAIVR
VMQLPDSGLEIRDRMWLKITIANAVIGADVVDWLYTHVEGFKERREARKYASSMLKHGFL
RHTVNKITFSEQCYYVFGDLCSNLASLNLNSGSSGASDQDTLAPLPHPSVPWPLGQGYPY
QYPGPPPCFPPAYQDPGFSYGSGSAGSQQSEGSKSSGSTRSSHRTPGREERRATGAGGSG
SESDHTVPSGSGSTGWWERPVSQLSRGSSPRSQASAVAPGLPPLHPLTKAYAVVGGPPGG
PPVRELAAVPPELTGSRQSFQKAMGNPCEFFVDIM
Download sequence
Identical sequences Q9WVB9
ENSRNOP00000026439 NP_114008.1.100692 NP_114008.1.4139 10116.ENSRNOP00000026439 ENSRNOP00000026439

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]