SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026719 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026719
Domain Number 1 Region: 796-999
Classification Level Classification E-value
Superfamily vWA-like 1.44e-44
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 2 Region: 416-596
Classification Level Classification E-value
Superfamily vWA-like 2.37e-44
Family Integrin A (or I) domain 0.00083
Further Details:      
 
Domain Number 3 Region: 36-199
Classification Level Classification E-value
Superfamily vWA-like 9.95e-44
Family Integrin A (or I) domain 0.00051
Further Details:      
 
Domain Number 4 Region: 623-796
Classification Level Classification E-value
Superfamily vWA-like 7.2e-42
Family Integrin A (or I) domain 0.00084
Further Details:      
 
Domain Number 5 Region: 1014-1207
Classification Level Classification E-value
Superfamily vWA-like 2.23e-40
Family Integrin A (or I) domain 0.00078
Further Details:      
 
Domain Number 6 Region: 228-402
Classification Level Classification E-value
Superfamily vWA-like 5.89e-39
Family Integrin A (or I) domain 0.001
Further Details:      
 
Domain Number 7 Region: 2004-2194
Classification Level Classification E-value
Superfamily vWA-like 4.13e-29
Family Integrin A (or I) domain 0.0021
Further Details:      
 
Domain Number 8 Region: 1785-1975
Classification Level Classification E-value
Superfamily vWA-like 1.53e-26
Family Integrin A (or I) domain 0.021
Further Details:      
 
Domain Number 9 Region: 2602-2661
Classification Level Classification E-value
Superfamily BPTI-like 2.84e-20
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.00042
Further Details:      
 
Domain Number 10 Region: 1224-1419
Classification Level Classification E-value
Superfamily vWA-like 0.00000000000000117
Family Integrin A (or I) domain 0.02
Further Details:      
 
Domain Number 11 Region: 2490-2568
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000154
Family Fibronectin type III 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026719   Gene: ENSRNOG00000019648   Transcript: ENSRNOT00000026719
Sequence length 2665
Comment pep:known chromosome:RGSC3.4:9:89990129:90043697:-1 gene:ENSRNOG00000019648 transcript:ENSRNOT00000026719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKHRHLPLVAVFSLLLSGITMTHAQQQSVMEVNKRDIVFLVDGSSSLGQANFNAIRDFI
SRVIQRLEIGQDLVQVSVAQYADTVKPEFYLNTYSTKKDAITTVRKMKALEGSALYTGSA
LDFVRNNLFTSSAGHRAAEGVPKLLVLITGGKSLDDVSQAAQELQKGSIMALVIGSRAAD
EDELKEIAFDSSLVFIPAEFRPAPLQSMLPSLMAPLRTLTGTTEEVKRDILFLFDGSVNV
MGQFPAVRDFLYRIIEELDVKPDGTRVAIAQFSDDVRVESRFNEHQTKAEILNLVKKMKL
KTGKGLNLGLALDHALRTIFVRSAGSRIEDNVQQFLVLLVAGRSTDAVAGPASSLKQRGV
IPFIFQAKNANPSELEQIVPSPAFILAAESLPKIGDLQSEIVGLLKAKQTSDTVSGEKDV
VFLIDGSEGVRSGFPLLKEFVQRVVESLDVGPNQVRVALVQYSDRTRPEFYLNSHMDQQG
VISAIRRLTLLGGPTPNTGAALDFVLRNILTSSTGSRIEEGVPQLLIVLTAERSGDDVRG
PSVVLKQGGAVPIGIGIGNADISEMQTISFIPDFAVAIPTFRELGTIQQVISERVIQLNR
EQLSSLTPVLMPSPSAGPGNKKDVVFLIDGSQNAGAEFQHIRTLIERLVEYLDIGFDTTR
VAVIQFSEDTKMEFPLNAHFSKDEVQNAVRRLRPKGGRQVYIGNALEYVLKNIFQRPLGS
RIEEGVPQFLVLISSGKSADEVDDSAVELKQFGVAPLTVARHTDQEELVKISLSPEYVFS
VSTFRELPRLEQRLLTPITTLTSQQIQQILASTRYPPSVAESDAADIVFLIDSSDAMKPD
GIAHIRDFVSRIVRRLNIGPNKVRIGVVQFSNDVFPEFYLKTHKSQNSVLEAIRRLRFKG
GSPLNTGRALEFVARNLFVKSAGSRIEDGVPQHLVLFLGGKSQDDVSRHAQVISSSGIMS
LGIGDRNIDRTDLQTITNDPRLVFTVREFRELPNIEERVMLSFGPSGPTPQPPEVEFPSS
RPEKKKADIVFLLDGSINFRRDSFQEVLRFASEIVDTVYEDGDSIRVGLVQYNSDPTDEF
FLRDFSTKRQIIDAINKVIYKGGRHANTRVGIEHLLKNHFVSEAGSRLDERVPQIAFVIT
GGKSVEDAQDVSLALTQKGVKVFAVGVRNIDSEEVGKIASNSATAFRVGSVQELSELSET
VLETLHDAMHETLCPGVTDVSKACNLEVILGFDGSRDQNVFVSQKGLESKVDTILNRISQ
IQRISCSSNQLPTVRVSVVANTPSGPVEAFDFAEYQPDLFEKFRTMRSQHPYVLTADTLK
LYQNKFRQSSPDTVKVVIHFTDGADGDMADLYRASEELRQAGVQALILVGLERVANLERL
MQVEFGRGFMYDRPLRLNLLDLDYELAEQLDNIAEKACCGVPCKCSGERGDRGPIGSIGP
KGISGEDGYRGYPGDEGGPGERGPPGVNGTQGFQGCPGQRGVKGSRGFPGEKGELGEIGL
DGLDGEEGDKGLPGSSGEKGSPGRRGDKGPKGDKGERGDVGIRGDPGDSGRDSQQRGPKG
ETGDIGPMGLPGRDGIPGSPGDPGKDGGFGRRGPAGAKGNRGGPGQPGFEGEQGTRGSQG
PPGPIGPPGLIGEQGIPGPRGGGGTAGAPGERGRTGPLGRKGEPGEPGPKGGTGNRGPRG
ETGDDGRDGVGSEGRRGKKGERGFPGYPGPKGTPGEPGADGPPGPKGIRGRRGNSGPPGV
VGQKGDPGYPGPSGHRGNRGDSVDQCALIQSIRDKCPCCYGPLECPVFPTELAFALDTSE
GVTQDTFSRMREVLLSIVGDLTIAESNCPRGARVAVVTYNNEVTTEIRFADSKKKSALLD
SIQNLQVALTSKQPSLETAMSFVARNTFKRVRNGFLMRKVAIFFSNQPTKPSLQLREAVL
KLSDAGITPLFLTSQEDRELINALQINNTAVGHALVLPARRDLRDFLKNVLTCHVCLDIC
NIDPSCGFGNWRPSFRDRRAAGSDVDIDLAFILDSSEATTLFQFNEMKKYISYMVRQLDL
SPDPKASQHFARVAVVQQATYESVDNTSVPPVKVEFSLTDYGAKEKLLDFLSRRMTQLQG
TMDLGNAIEYTIENIFESAPNPRDLKIVVLMLTGEIPREQLEEAQRAILQAKCKGYFFVV
LGIGRKVNVKEVYSFASEPNDVFFKFMDKSTELNEEPLMRFGRLLPSFVGSGNAFYLPPD
LRKQCDWFQGDQPVKNGVKFGHRQINTPHTVNSSLTSKVVTTMKPVTTTKPTSIVNLPPA
KPAPVRPAPAQPVLAKPDPAKPVSAKSVPPQPVHAQPDPAQPVHVQSASAQTASAKPAPA
KPAPPQTAAAKPAPPQTAAAKPAPPQTAAAKPAPPQTAAAKPPVPVKPAVPAQPAPAQPP
APAQPVLTKPAAMKPASANKPVAAKPVATNTATVRPASAVKPAAASKPAATRPLPAAVRP
VATKPEAPRPQAKPAATKPATTKPMARVSREVQVSEVTENSARLHWERPEPSSSYFYDLT
VTSAHDQSLVLRQNLTVTDRVIGGLLAGQLYHVVVVSYLQSQVRAIYQGSFNTKKTQPPV
LQAAHRASSSTINLMVNTEPLFLTKTDICKLPKDAGTCEDFKLLWHYDLESKSCKRFWYG
GCGGNENRFHSQEECEKMCSPALSV
Download sequence
Identical sequences 10116.ENSRNOP00000026707 ENSRNOP00000026719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]