SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026820 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026820
Domain Number 1 Region: 60-446
Classification Level Classification E-value
Superfamily PLP-dependent transferases 3.99e-108
Family Cystathionine synthase-like 0.00000000106
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026820   Gene: ENSRNOG00000019736   Transcript: ENSRNOT00000026820
Sequence length 459
Comment pep:known chromosome:RGSC3.4:3:146528821:146551156:-1 gene:ENSRNOG00000019736 transcript:ENSRNOT00000026820 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVGSVAGNMLLRAAWRRASLAATSVALRRSSVPTRGLRLRVVDHAPHSAVPSEAEAVLRP
LYMDVQATTPLDPRVLDAMLPYLVNYYGNPHSRTHAYGWESEAAMERARQQVASLIGADP
REIIFTSGATESNNIAIKGVARFYRSRKKHLVTTQTEHKCVLDSCRSLEAEGFRVTYLPV
QKSGIIDLKELEAAIQPDTSLVSVMTVNNEIGVKQPIAEIGQICSSRKLYFHTDAAQAVG
KIPLDVNDMKIDLMSISGHKLYGPKGVGAIYIRRRPRVRVEALQSGGGQERGMRSGTVPT
PLVVGLGAACELAQQEMEYDHKRISKLAERLIQKIMKNLPDVVMNGDPKQHYPGCINLSF
AYVEGESLLMALKDVALSSGSACTSASLEPSYVLRAIGTDEDLAHSSIRFGIGRFTTEEE
VDYTVQKCIHHVKRLREMSPLWEMVQDGIDLKSIKWTQH
Download sequence
Identical sequences B4G169 Q3MHT2
ENSRNOP00000026820 ENSRNOP00000066678 ENSRNOP00000026820 10116.ENSRNOP00000026820 NP_445914.2.100692 XP_003749657.1.100692 XP_017458139.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]