SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026843 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026843
Domain Number 1 Region: 476-822
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 6.02e-115
Family Rap/Ran-GAP 0.000000599
Further Details:      
 
Domain Number 2 Region: 949-1025
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000173
Family PDZ domain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000026843
Domain Number - Region: 1653-1700
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0915
Family Myosin rod fragments 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026843   Gene: ENSRNOG00000019791   Transcript: ENSRNOT00000026843
Sequence length 1722
Comment pep:known chromosome:RGSC3.4:19:55622546:55775008:-1 gene:ENSRNOG00000019791 transcript:ENSRNOT00000026843 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSDPRPSQAEKHKLGRAASKFKDPSRAMQSDDYFARKFKAINGSMGPATLNTSSLSEGGG
GGGGPANGTPAVPKMGVRARVSEWPPKKDCSKDLACKTLWESRSQSSYESATSIIQNGQN
DQVDRQQEEQLDLDFVEAKYTIGDIFVHSPQRGLHPIRQRSNSDITISDIDTEDVLDQHA
VNPNTGAALHREYGSTSSIDRQGLSGENVFAMLRGYRIESYDPKVTSSFGFPDFFPCDTA
ISPSLHAAAQISRGEFVRISGLDYMDGGLLMGRDRDKPFKRRLKSESVETSLFRKLRTVK
SEHETFKFTSDLEEGRLDRGIRPWSCQRCFAHYDVQSILFNINEAMATRASVGKRKNITT
GASAASQTPVPVGPAGGCESPLGSKEDLNSKENPDADEGDGKSNDLVLSCPYFRNETGGE
GDRRIALSRANSASFSSGESCSFESSLSSHCTNAGVSVLEVPRENQPIHREKVKRYIIEH
VDLGAYYYRKFFYGKEHQNYFGIDENLGPVAVSIRREKVEDPREKEGSQFNYRVAFRTSE
LTTLRGAILEDAVPSTARHGTARGLPLKEVLEYVIPELSIPCLRQAANSPKVPEQLLKLD
EQGLSFQHKIGILYCKAGQSTEEEMYNNETAGPAFEEFLDLLGQRVRLKGFSKYRAQLDN
KTDSTGTHSLYTTYKDFELMFHVSTLLPYMPNNRQQLLRKRHIGNDIVTIIFQEPGALPF
TPKNIRSHFQHVFVIVKVHNPCTENVCYSVGVSRSKDVPPFGPPIPKGVTFPKSAVFRDF
LLAKVINAENAAHKSEKFRAMATRTRQEYLKDLAENFVTTTTVDTSAKFSFITLGAKKKE
RVKPRKDAHLFSIGAIMWHVVARDFGQSADIECLLGISNEFIMLIEKESKNVVFNCSCRD
VIGWTSGLVSIKIFYERGECILLSSVDNSSEDIREIVQRLVIVTRGCETVEMTLRRNGLG
QLGFHVNFEGIVADVEPFGFAWKAGLRQGSRLVEICKVAVATLTHEQMIDLLRTSVTVKV
VIIQPHEDGSPRRGCSELCRIPMVEYKLDSEGTPCEYKTPFRRNTTWHRVPTPALQPVSR
ASPVPGTPDRLQCQPLLQQAQAAIPRSTSFDRKLPDGTRSSPSNQSSSSDPGPGGSGPWR
PQVGYDGCPSPLLLEPQGPGSVECDGSGDHEDLMEGGRLPETKWHGPPSKVLSSYKERAL
QKDGSCKDSPNKLSHIGDKSCSSHSSSNTLSSNTSSNSDDKHFGSGDLMDPELLGLTYIK
GASTDSGIDTTPCMPATILGPMHLTGSRSLIHSRAEQWADAADVSGADEDPAKMYTLHGY
ASAISSSAADGSMGDLSEVSSHSSGSHRSGSPSTHCSKSTGSLDSSKVYIVTHSGGQQVP
GAVAKPYHRQGAANKYVIGWKKSEGSPPPEEPEVTECPRIYGEMDIMSTASQHPAVVGDS
VPEAQHVLSKDDFLKLMLPDSPLVEEGRRKFSFYGNLSPRRSLYRTLSDESVCSNRRGSS
FASSRSSILDQALPNDILFSTTPPYHSTLPPRTHPAPSMGSLRNEFWFSDGSLSDKSKCA
DPGLMPLPDTAAGLDWSHLVDAARAFEGLDSDEELGLLCHHASYLDQRVASFCTLTDLQH
GQELEGAPELSLCVDPTSGKEFMDTPGERSPSTLTGKVNQLELILRQLQTDLRKEKQDKA
VLQAEVQHLRQDNMRLQEESQTATAQLRTFTEWFFSTIDKKV
Download sequence
Identical sequences F1M8G8
ENSRNOP00000026843 10116.ENSRNOP00000026843 XP_017456819.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]