SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000026986 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000026986
Domain Number 1 Region: 82-382
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.34e-75
Family Protein kinases, catalytic subunit 0.0000201
Further Details:      
 
Domain Number 2 Region: 28-104
Classification Level Classification E-value
Superfamily SH3-domain 4.27e-22
Family SH3-domain 0.00051
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000026986
Domain Number - Region: 391-465
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.053
Family Regulator of G-protein signaling, RGS 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000026986   Gene: ENSRNOG00000019931   Transcript: ENSRNOT00000026986
Sequence length 996
Comment pep:known chromosome:RGSC3.4:19:56136433:56167797:1 gene:ENSRNOG00000019931 transcript:ENSRNOT00000026986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALPVAEGTAGTSLSPVRDDSGSSSSGMWAALYDYEARGEDELSLKRGQLVEVLSQDAAV
SGDEGWWAGQVQRRLGIFPASYVAPCSSVSPPSPPPPRPCSPVHVDFERLELKELIGAGG
FGQVYRATWQGQEVAVKAARRDPEQDAAAAAESVRREARLFAMLRHPNIIQLRGVCLQQP
HLCLVLEFARGGALNRALAAAAPDPRVPGPRRARRIPPHVLVNWAVQIARGMLYLHEEAV
VPILHRDLKSSNILLLEKIEHDDICNKTLKITDFGLAREWHRTTRMSAAGTYAWMAPEVI
RSSLFSKGSDIWSYGVLLWELLTGEVPYRGIDGLAVAYGVAVNKLTLPIPSTCPEPFAKL
MKECWEQDPHIRPSFALILKQLTAIEEAVLTDLPQESFHSMQEDWKLEIQQMFSELRTKE
KELRSREEELSRAALQQKSQELLLRRREQQLAEREIDVLERELNVLIFQLSQEAPHVKKR
KGRFRRGRLRLKDGHRISLPSDFQHKITVQASPTLDKRRSSDSGLCSPPGSPLMLPRLRA
IQLTSDENNKTRGRNVVFRQEDFEVVKRNFKRKGCTWGPSSIQTKGRPEGRERVRPLSDG
NSPWSSLLIKSQKTTPLASLFVDQPGSCEEQKLVPDGLEHKKPKQTKSPGQAYVGLPLCK
DSQREDSLEAESREEGPSKGSPVNSVGAPFLKKKTESALCECGVLLASMALGLDVRKLHG
AQVPTKPSPKDEKKGEGAVQLVSRCQTSSSPLLRQPSAGRAPSDGSTLLLSATSLLSKSS
LSMKCLLQAGEEEAPLGNTQVSCGPTTITPDPSSAAPESTLTPGLRLKADCGVLRSVPPA
ILEQTGERLPGCSTAGDKECHRVQMGSNEIPLRPQSAPGDYGPPHSPSPGPQTDLASQDS
PVQPQVVLGKCQACPAPPQRPQTASLRTTPPAAWACDKDHAVPAFACFLGAQERSRCQVL
DTSLEGQNKDRAMPLCRVKSVMCQPSIYALEKDFLT
Download sequence
Identical sequences 10116.ENSRNOP00000026986 ENSRNOP00000026986

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]