SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027050 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027050
Domain Number 1 Region: 18-184
Classification Level Classification E-value
Superfamily UBC-like 4.66e-46
Family UBC-related 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027050   Gene: ENSRNOG00000019953   Transcript: ENSRNOT00000027050
Sequence length 185
Comment pep:known chromosome:RGSC3.4:9:90480334:90515909:1 gene:ENSRNOG00000019953 transcript:ENSRNOT00000027050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTLASKLKRDDGLKGSRASASTSDSTRRVSVRDKLLVKEVAELEANLPCTCKVHFPDPN
KLHCFQLTVSPDEGYYQGGKFQFETEVPDAYNMVPPKVKCLTKIWHPNITETGEICLSLL
REHSIDGTGWAPTRTLKDVVWGLNSLFTDLLNFDDPLNIEAAEHHLRDKEDFRDKVDEYI
KRYAR
Download sequence
Identical sequences Q5U203
ENSRNOP00000027050 XP_006245484.1.100692 XP_006245485.1.100692 XP_006245487.1.100692 XP_006245489.1.100692 XP_017452028.1.100692 10116.ENSRNOP00000027050 ENSRNOP00000027050

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]