SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027091 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027091
Domain Number 1 Region: 18-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 2.22e-23
Family Ribosomal L11/L12e N-terminal domain 0.00041
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 9.29e-18
Family Ribosomal protein L11, C-terminal domain 0.00075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027091   Gene: ENSRNOG00000019970   Transcript: ENSRNOT00000027091
Sequence length 203
Comment pep:known chromosome:RGSC3.4:1:207580240:207583061:1 gene:ENSRNOG00000019970 transcript:ENSRNOT00000027091 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLSRVTRTLKKPEAGGVIRSIVRAGQAIPGPPLGPILGQRGVSINQFCKEFNEKTKDI
KEGIPLPTKIFIKPDRTFELKIGQPTISYFLKAAAGIEKGARQTGKEVAGLVSLKHVYEI
ARVKAKDEAFAMQDVPLSSIVRSIIGSARSLGIRVVKDLSVDELAAFQKERAVFLAAQKR
RIWQLRQKLPKSDPNLLHSEVRD
Download sequence
Identical sequences Q5XIE3
10116.ENSRNOP00000027091 ENSRNOP00000027091 NP_001006974.1.100692 NP_001006974.1.4139 ENSRNOP00000027091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]