SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027220 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027220
Domain Number 1 Region: 21-428
Classification Level Classification E-value
Superfamily PLP-dependent transferases 6.44e-151
Family Cystathionine synthase-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027220   Gene: ENSRNOG00000020083   Transcript: ENSRNOT00000027220
Sequence length 432
Comment pep:known chromosome:RGSC3.4:9:90525575:90546158:1 gene:ENSRNOG00000020083 transcript:ENSRNOT00000027220 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDVARNGARGSVESPPNRKVYMDYNATTPLEPEVIQAVTEAMKEAWGNPSSSYVAGRKAK
DIINTARASLAKMIGGKPQDIIFTSGGTESNNLVIHSTVRCFHEQQTLQGRTVDQISPEE
GTRPHFITCTVEHDSIRLPLEHLVEDQVAEVTFVPVSKVNGQVEVEDILAAVRPTTCLVT
IMLANNETGVIMPISEISRRIKALNQIRAASGLPRVLVHTDAAQALGKRRVDVEDLGVDF
LTIVGHKFYGPRIGALYVRGVGKLTPLYPMLFGGGQERNFRPGTENTPMIAGLGKAADLV
SENCETYEAHMRDIRDYLEERLEAEFGKRIHLNSRFPGVERLPNTCNFSIQGSQLRGYMV
LAQCQTLLASVGASCHSDHEDRPSPVLLSCGIPVDVARNAVRLSVGRSTTRAEVDLIVQD
LKQAVNQLEGPV
Download sequence
Identical sequences Q68FT9
NP_001007756.1.100692 NP_001007756.1.4139 3a9x_A 3a9x_B 3a9y_A 3a9y_B 3a9z_A 3a9z_B ENSRNOP00000027220 ENSRNOP00000027220 10116.ENSRNOP00000027220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]