SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027379 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027379
Domain Number 1 Region: 42-231
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.65e-67
Family Regulator of G-protein signaling, RGS 0.0000000128
Further Details:      
 
Domain Number 2 Region: 454-681
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.71e-60
Family DBL homology domain (DH-domain) 0.000000493
Further Details:      
 
Domain Number 3 Region: 683-817
Classification Level Classification E-value
Superfamily PH domain-like 1.18e-38
Family Pleckstrin-homology domain (PH domain) 0.0000219
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027379   Gene: ENSRNOG00000020130   Transcript: ENSRNOT00000027379
Sequence length 979
Comment pep:known chromosome:RGSC3.4:1:80209480:80226352:1 gene:ENSRNOG00000020130 transcript:ENSRNOT00000027379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGEVAGGAAPGPPRSGLVHLWGGTGGGSSLVPTQQNPEDQNSQFQSLEQVKRRPAHLMAL
LQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFYHSFLEKTAVLRVPVPPSVAFEL
DRTRPDLISEDVQRRFIQEVVQSQQAAVTRQLEDFRSKRLMGMTPWEQELSLLEPWIGKD
RGNYEARERHVAERLLSHLEEMQHTISTDEEKSAAVVTAISLYMRHLGVRTKSGDKKSGR
NFFRKKVMGNRRSDEPPKTKKGLSSILDPARWNRGEPSAPDCRHLKVEVDEKPGPADRKG
SLGISSRDRTVGTPGQDNPGVSLHPLSVDSLDSREPGVDTPQEPGDTPPQGPTSLEPLAP
PESTEDNGETERCPLRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMDPGS
ATAVLGPTRRATPEPGDDGEPGRSGLEQEPEEPPGWRELVPSDTLLGLPKNQVKRQEVIS
ELLVTEAAHVRMLRVLHDLFYQPMAEGGFFPLEELQNIFPSLDELIEVHSLFLDRLMKRR
QESGYLIEEIGDVLLARFDGAEGSWFQKISSRFCSRQSFALEQLKAKQRKEPRFCAFVQE
AESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEEPAERAKVELAAECCREILHHV
NQAVRDMEDLLRLKDYQRRLDLTHLRQSNDPMLSEFKNLDITKKKLVHEGPLTWRLTKDK
AVEVHVLLLDDLLLLLQRQDERLLLKSHSRTLTPTPDGKTMLRPVLRLTSAMTREVATDH
KAFYVIFTWDQEAQIYELVAQTSSERKSWCALITETAGSLKVPAPASRPKPRPSPSSTRE
PLLSSSENGTGGTEAAPADARTERILNDLLPFCRPGPEGQLAATALQKVLSLKQILLSTE
EDSGAGPPRDGDGVPGGGAPGPTHTQEVEENLLSLEVVIKQLEELEEEFCRLRPFLSQLG
EILSPNLAAPERSAQTGLS
Download sequence
Identical sequences ENSRNOP00000027379 10116.ENSRNOP00000027379

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]