SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027561 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027561
Domain Number 1 Region: 171-282
Classification Level Classification E-value
Superfamily PH domain-like 1.19e-37
Family Pleckstrin-homology domain (PH domain) 0.01
Further Details:      
 
Domain Number 2 Region: 67-177
Classification Level Classification E-value
Superfamily PDZ domain-like 2.5e-25
Family PDZ domain 0.00033
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000027561
Domain Number - Region: 319-418
Classification Level Classification E-value
Superfamily PH domain-like 0.00958
Family Pleckstrin-homology domain (PH domain) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027561   Gene: ENSRNOG00000020344   Transcript: ENSRNOT00000027561
Sequence length 522
Comment pep:known chromosome:RGSC3.4:19:36782024:36866477:1 gene:ENSRNOG00000020344 transcript:ENSRNOT00000027561 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWTRATKAGLVELLLRERWVRVVAELSGESLSLTGDAAAVEPEPPAVAFNGLPNGGGG
GGDSLPGSPNRGLGPPSPPAPPRGPAGEASASPPVRRVRVVKQEAGGLGISIKGGRENRM
PILISKIFPGLAADQSRALRLGDAILSVNGTDLRQATHDQAVQALKRAGKEVLLEVKFIR
EVTPYIKKPSLVSDLPWEGASPQSPSFSGSEDSGSPKHQNTTKDRKVIPLKMCFAARNLS
MPDLENRLIELHSPDSRNTLILRCKDTATAHSWFVAIHTNIMALLPQVLAELNAMLGATS
TAGGSKEVKHIAWLAEQAKLDGGRQQWRPVLMAVTEKDLLLYDCMPWTRDAWASPCHSYP
LVATRLVHSGSGCRSPSLGSDLTFATRTGSRQGIEMHLFRVETHRDLSTWTRILVQGCHA
AAELIKEVSLGCTLSGQDVRFTVHYEHGFTITRDNGGTSSILYRYPFERLKMSADDGIRN
LYLDFGGPEGELTMDLHSCPKPIVFVLHTFLSAKVTRMGLLV
Download sequence
Identical sequences D3ZMX6
10116.ENSRNOP00000027561 ENSRNOP00000027561 NP_001162145.1.100692 NP_001162145.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]