SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027763 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027763
Domain Number 1 Region: 290-420
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 6.02e-43
Family Regulator of G-protein signaling, RGS 0.00000298
Further Details:      
 
Domain Number 2 Region: 16-118
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.31e-25
Family DEP domain 0.0057
Further Details:      
 
Domain Number 3 Region: 218-278
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 5.75e-17
Family Transducin (heterotrimeric G protein), gamma chain 0.005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027763   Gene: ENSRNOG00000020459   Transcript: ENSRNOT00000027763
Sequence length 467
Comment pep:known chromosome:RGSC3.4:10:15469922:15477822:1 gene:ENSRNOG00000020459 transcript:ENSRNOT00000027763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATVRGCTPHRGCSRMQRPHLSKMERVVVSMQDPDQGVKMRSQRLLITVIPHAVAGRDIV
EWLVQKFCISEEEALHLGTLLTQHGYIYPLRESRDLTLRPDETPYRFQVRLAWFTEQWXX
XXLDYAIYLAKKNIQKQGALVDYEKEHYTLLHKKINHAWDLVLMQAREQLRAAKQRRKGD
RLVISCQEQTYWLVNKPPPGAPNVLEQGPERGSDNPSQVQMSSDFYKCEIECFRKALSRN
RVKSSVCLEAYLKFSSQHGPHDPILSGCLPSNPWITDDVTYWVMNAPNVAAPTKLRVERW
SFSFRELLDDPVGRIHFMDFLQKEFSAENLSFWEACEELRFGGQAQVPTLVDSVYQQFLA
PGAARWINIDSRTMEWTLEGLRQPHRYVLDAAQLHIYMLMKKDSYPRFLKSDIYRGLLEE
AVIPLETKRWPFPFLRKPLHSSPSPALQSTSGEPAATSSPAGGNEED
Download sequence
Identical sequences ENSRNOP00000027763 10116.ENSRNOP00000027763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]