SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027784 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027784
Domain Number 1 Region: 208-353
Classification Level Classification E-value
Superfamily PH domain-like 5.88e-46
Family Phosphotyrosine-binding domain (PTB) 0.00000293
Further Details:      
 
Domain Number 2 Region: 380-477
Classification Level Classification E-value
Superfamily PDZ domain-like 5.26e-20
Family PDZ domain 0.00034
Further Details:      
 
Domain Number 3 Region: 479-557
Classification Level Classification E-value
Superfamily PDZ domain-like 0.000000000000025
Family PDZ domain 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027784   Gene: ENSRNOG00000020466   Transcript: ENSRNOT00000027784
Sequence length 569
Comment pep:known chromosome:RGSC3.4:7:9930015:9934987:-1 gene:ENSRNOG00000020466 transcript:ENSRNOT00000027784 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEFLPEPQHPPGPPTMDLEEPKGPEVPSEDHPSNTQWALGPRGPDTLSEMELDTSSVRAL
VQQLEALPSDLGGQFPDGAPCPLHIATGQGLATQENLDAGGLLSAEAGGDNLLGLLRCEA
SLPAQSVPPDPAQAAPRLLQPPEDPGGDPGWMEGTEPADNRSSSSSPELWLETAPLVTHR
DPPVGTQSQETLASCPAVSEVPGPCGQEELMDGVLFGAKYLGSTQLLSERNPPPSTRMGQ
AQEAMDRVKAPEGETQPMTEVDIFISTKRVKVLAADSQDALMDHALQTISYIADIGPVLV
LMARRRLAKRTTSQDRQRQLYKMLCHVFHSEDAQLIAQAIGQAFSIAYSQFLQENRIDPS
QVGMQPSASASHPHNGDLDHFCNSQNCREVCIQKRPGEGLGVALVESGWGSLLPTAVIAN
LLHGGPAERCGALSIGDRVTAINGTSLVGLSLAACQAAVREVRRHSSVTLSIIHCPPVTT
AVIHRPHVREQLGFCVENGIICSLLRGSAAERGGVRVGHRIIEVNGQSVVAMPHARIIQL
LTETREIHIKTMPAATYRLLTGQEQPVYL
Download sequence
Identical sequences O70248
ENSRNOP00000027784 ENSRNOP00000027784 10116.ENSRNOP00000027784 XP_006241082.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]