SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027847 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027847
Domain Number 1 Region: 355-465
Classification Level Classification E-value
Superfamily PDZ domain-like 2.23e-26
Family PDZ domain 0.0053
Further Details:      
 
Domain Number 2 Region: 6-99
Classification Level Classification E-value
Superfamily PDZ domain-like 2.76e-23
Family PDZ domain 0.00056
Further Details:      
 
Domain Number 3 Region: 180-272
Classification Level Classification E-value
Superfamily PDZ domain-like 3.94e-17
Family PDZ domain 0.028
Further Details:      
 
Domain Number 4 Region: 652-762
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.0000000000000354
Family Nucleotide and nucleoside kinases 0.0015
Further Details:      
 
Domain Number 5 Region: 466-543
Classification Level Classification E-value
Superfamily SH3-domain 0.0000433
Family SH3-domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027847   Gene: ENSRNOG00000020501   Transcript: ENSRNOT00000027847
Sequence length 904
Comment pep:known chromosome:RGSC3.4:7:9917359:9930081:1 gene:ENSRNOG00000020501 transcript:ENSRNOT00000027847 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEELTIWEQHTATLYKDPRRGFGIAVSGGHDRAGGPVVVSDVVPGGPAEGRLQTGDHIVM
VNGVSVENVTSAFAIQILKTCTKTANITVKRPRRVQLPATKASPASGHQLSDQEEADHGR
GYEGDSSSGSGRSWGERSRRSRAGRRVRMGSHGRRSSCGGSEANGLDLVSGYKRLPKQDV
LMRPLKSVLVKRRNSEEFGVKLGSQIFIKHITESGLAARNRGLQEGDLILQINGVSSANL
SLSDTRRLIEKSEGQLTLLVLRDSGQFLVNIPPAVSDSDSSLMEDISDLTSELSQAPPSH
IPPPPLKSRRSPEDSQTDSPVETPQPQRRERSVDSRAIAEPESPGESRYDIYRVPSRQSL
EDRGYSPDTRVVRFPKGVSIGLRLAGGNDVGIFVSGVQAGSPADGQGIQEGDEILQVNDM
PFRNLTREEAVQFLLGLPAGEDVELVIQSKQDIFRKMVQSRVGDSFYIRTHFELEPSPPY
GLGFTRGDVFHVVDTLYRGSGSGHGHSSHGGLWLAARMGRDLREQERGVIPNQSRAEQLA
SLEAAQRAAGLGPGASTGSNPRAEFWRLRGLRRGAKKTMTQRSREDLSALTRQGHYPPYE
RVVLREASFKRPVVILGPVADIAMKRLTTEVPEQFEIAESVSRTDSPSKIIKLDTVRVIA
ERDKHALLDVTPSAIERLNYVQYYPVVIFCAPESRSALKALREWLAPASRRSSRRLYAQA
QKLQKHSGHLFTATIPLNGTSDSWYQEVKAVIQQQQARPIWTAEDQLNGSSEDLDLPGHG
LAASSGDLSCDSRANSDYEDTDGEGTYTDREGEPQDFDEEAPPTALARSSEPVWVDDHQG
LMGHGRIAAAEVQLQADSHYTPDQRRQDSMRTYKHEALRKKFTRARDIESSDEEGYDWGP
ATDL
Download sequence
Identical sequences 10116.ENSRNOP00000027847 ENSRNOP00000027847

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]