SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027860 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027860
Domain Number 1 Region: 170-366
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.21e-57
Family Prokaryotic proteases 0.000000653
Further Details:      
 
Domain Number 2 Region: 381-477
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-22
Family HtrA-like serine proteases 0.0034
Further Details:      
 
Domain Number 3 Region: 36-122
Classification Level Classification E-value
Superfamily Growth factor receptor domain 1.88e-16
Family Growth factor receptor domain 0.00089
Further Details:      
 
Domain Number 4 Region: 110-155
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000109
Family Ovomucoid domain III-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027860   Gene: ENSRNOG00000020533   Transcript: ENSRNOT00000027860
Sequence length 480
Comment pep:known chromosome:RGSC3.4:1:190257874:190308326:1 gene:ENSRNOG00000020533 transcript:ENSRNOT00000027860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFLRTALLSLLLLLLAAPSLALPSGISRSAPAATVCPEHCDPTRCAPPPTDCEGGRVRD
ACGCCEVCGALEGAVCGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCG
SDAKTYTNLCQLRAASRRSEKLRQPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIA
PAVVHIELYRKLPFSKREVPVASGSGFIVSEDGLIVTNAHVVTNKNRVKVELKNGATYEA
KIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVVAIGSPFSLQNTVTTGIVSTT
QRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAGISFAIPSDKI
KKFLTESHDRQAKGKTVTKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD
TPAEAGGLKENDVIISINGQSVVTANDVSDVIKKENTLNMVVRRGNEDIVITVVPEEIDP
Download sequence
Identical sequences Q9QZK5
NP_113909.1.100692 NP_113909.1.4139 ENSRNOP00000027860 10116.ENSRNOP00000027860 ENSRNOP00000027860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]