SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027890 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027890
Domain Number 1 Region: 72-443
Classification Level Classification E-value
Superfamily SAICAR synthase-like 4.25e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000671
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027890   Gene: ENSRNOG00000020577   Transcript: ENSRNOT00000027890
Sequence length 688
Comment pep:known chromosome:RGSC3.4:7:9881778:9909651:-1 gene:ENSRNOG00000020577 transcript:ENSRNOT00000027890 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELEVPDEAESAEAGAVTAEAAWSAESGAAAGMTQKKAILAEAPLVTGQPGPGHGKKLGH
RGVDASGETTYKKTTSSTLKGAIQLGIGYTVGNLSSKPERDVLMQDFYVVESIFFPSEGS
NLTPAHHFQDFRFKTYAPVAFRYFRELFGIRPDDYLYSLCNEPLIELSNPGASGSVFYVT
SDDEFIIKTVMHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQSGGKNIRVVVMNN
VLPRVVKMHLKFDLKGSTYKRRASKKEKEKSLPTYKDLDFMQDMPEGLLLDSDTFGALVK
TLQRDCLVLESFKIMDYSLLLGVHNIDQQERERQAEGAQSKADEKRPVAQKALYSTAMES
IQGGAARGEAIETDDTMGGIPAVNGRGERLLLHIGIIDILQSYRFIKKLEHTWKALVHDG
DTVSVHRPSFYAERFFKFMSSTVFRKSSSLKSSPSKKGRGALLAVKPLGPTAAFSASQIP
SEREDVQYDLRGARSYPTLEDEGRPDLLPCTPPSFEEATTASIATTLSSTSLSIPERSPS
DTSEQPRYRRRTQSSGQDGRPQEELHAEDLQKITVQVEPVCGVGVVVPKEQGAGVEVPPS
GASAAATVEVDAASQASEPASQASDEEDAPSTDIYFFAHGRYWLFSPRRRQLRAVTPSHT
GAPTDERSWVYSPLHYSARPASDGESDT
Download sequence
Identical sequences F1M8H6
ENSRNOP00000027890 10116.ENSRNOP00000057873 ENSRNOP00000057873

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]