SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027951 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027951
Domain Number 1 Region: 67-182
Classification Level Classification E-value
Superfamily PDZ domain-like 1.07e-17
Family PDZ domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027951   Gene: ENSRNOG00000020593   Transcript: ENSRNOT00000027951
Sequence length 297
Comment pep:known chromosome:RGSC3.4:7:9860578:9865267:1 gene:ENSRNOG00000020593 transcript:ENSRNOT00000027951 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSAAPREPGATEPPARARPRLVFRTQLAHGSPTGRIEGFTNVRELYAKIAEAFGIAPTE
ILFCTLNSHKVDMQKLLGGQIGLEDFIFAHVRGETKEVEVTKTEDALGLTITDNGAGYAF
IKRIKEGSIINRIEAVCVGDSIEAINDHSIVGCRHYEVAKMLRELPKSQPFTLRLVQPRR
AFDMIGQRSRSSKCPVEAKVSSGRETLRLRSGGAATVEEAPSDVEAAAARRVDDLLESYM
GIRDPELAAAVVETARSSVGAQAFARGLDAVLGEFAFPDEFVVEVWAAIGEAHDACG
Download sequence
Identical sequences D3ZEK6
NP_001102752.1.100692 NP_001102752.1.4139 ENSRNOP00000027951 ENSRNOP00000027951 10116.ENSRNOP00000027951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]