SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000027994 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000027994
Domain Number 1 Region: 33-219
Classification Level Classification E-value
Superfamily vWA-like 4.45e-48
Family Integrin A (or I) domain 0.00042
Further Details:      
 
Domain Number 2 Region: 1037-1233
Classification Level Classification E-value
Superfamily vWA-like 9.24e-29
Family Integrin A (or I) domain 0.0048
Further Details:      
 
Domain Number 3 Region: 230-410
Classification Level Classification E-value
Superfamily Fibronectin type III 4.64e-22
Family Fibronectin type III 0.0014
Further Details:      
 
Domain Number 4 Region: 778-954
Classification Level Classification E-value
Superfamily Fibronectin type III 1.74e-17
Family Fibronectin type III 0.0023
Further Details:      
 
Domain Number 5 Region: 421-594
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-16
Family Fibronectin type III 0.001
Further Details:      
 
Domain Number 6 Region: 2874-2931
Classification Level Classification E-value
Superfamily BPTI-like 0.00000000000000539
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0024
Further Details:      
 
Domain Number 7 Region: 599-772
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000578
Family Fibronectin type III 0.0029
Further Details:      
 
Domain Number 8 Region: 957-1042
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000000994
Family Fibronectin type III 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000027994   Gene: ENSRNOG00000020579   Transcript: ENSRNOT00000027994
Sequence length 2942
Comment pep:known chromosome:RGSC3.4:8:113971207:114003101:1 gene:ENSRNOG00000020579 transcript:ENSRNOT00000027994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLRLLVAALCTAEILVGAPGVWAQPRDRVTCTRLYAADIVFLIDGSSSIGRSNFEVRGF
LEGLVLPFSGAANAQGVRFATVQYSDDPQTEFGLDTLGSGGDTIRAIRELSYKGGNTRTG
AALLHVSDRVFLPHLTRPGIPKVCILITDGKSQDLVDTAAQKLKRQGVKLFAVGIKNADP
EELKRIASQPTSDFFFFVNDFSILRTLLPLISRRVCTTAGGVPVTLPSDDTPSGPRDLVL
SEPSSQSLRVQWTAASGPVTGYKIQYTPLTGLGQPLPSERKEVNVPAGETSMRLQGLRPL
TDYQVTVVALYANSIGEAVSGTARTTAKEGLELSVQNITSHSLLVAWRRVPGANGYRVTW
RDLSGGGAQQQDLSPGQGSVFLDHLKPGTDYEVTVSALFGRSVGPAASLTTRTASSVEQT
LRPIILSPTSILLSWNLVPEARGYRLEWHRESGLEPPQKVELLPDVTRYQLDGLQPGTEY
RLTLYTLLEGREVATPATVVPTGLEQLVGPVMNLQATELPGQRLRVSWNPVLGATEYRFT
VRTPQGVERTLLLPGSQTTFDLDDVRAGISYTVRVSARVGTHEGDASTLTIHRDQEAPLI
IPGLQVVASDATRIRVAWGLVPGASGFRISWRTGSGPESSQTLAPDSTVTDILGLQPGTS
YQVAVSALRGREEGPPVVIVARTDPLGPVRRVHLTQAGSSSVSITWTGVPGATGYRVSWH
SGHGVQKISMVSGTPPWAEIDGEPDTEYIVPVRTHVAGVDGAPASVVVRTAPEPVGSVSK
LQILNASSDVLRVTWVGVPGATSYRLAWGRSEGGPMRHQIVPGNKDSAEITGLEGGVSYS
VRVTALVGDREGAPVSIVVTTPPEVPAPLETLQVVQSGEHSLRLHWNRVPGAQGFRLHWQ
PEGGQEQSLTLGPESNSYNLVGLEPATKYHVWLSVLGQPGEAAPRKVTAYTETPHIPSTG
LRVVDTSVNSVTLTWTPVSGASSYILSWRPLRGTGQEVPGGPQTLPGNSSSHRVTGLEPG
VPYVFSLTPIQSGVRGSEITVTQKPACPHGQVDVVILLHATRDNAHNAEAVKRFLERLVS
ALGPLGPQAAQVGLLSYSHRPSPLFPLNSSHDLGVILQKIRDIPYVDPSGNNLGTAVTTA
HRYLLAPNAPGRRRQVPGVMVLLVDEPLREDILSPIREAQASGLKVMMLGLVGADPEQLR
LLAPGMDPIQTFFAVDNGLDLDRAGSDLAVALCQAAVAIQPQLEPCAVPCPKGQKGEPGV
TGPQGQAGPPGPPGLPGRTGAPGPQGAPGSTQAKGERGFPGPEGPPGSPGLPGVPGSPGV
KGSPGWSGPRGDRGERGPQGPKGEPGEPGQVIGGGRPGLPGKKGDPGPSGPPGPHGPLGD
PGPRGPPGLPGTSVKGDKGDRGERGPPGPGTGASEQGSPGLPGLPGSPGPQGPPGRTGEK
GEKGDCEDGGPGLPGQPGVPGEPGLRGAPGVTGPKGDRGLTGTPGEPGEKGERGPPGPVG
PQGLPGAAGRPGVEGPEGPPGPPGRRGEKGEPGRPGDPALGPGGAGAKGEKGDAGLPGPR
GASGIKGEQGAPGLALPGDPGPKGDPGDRGPIGLTGRAGPTGDSGPPGEKGEPGRPGSPG
PVGPRGRDGEAGEKGDEGAPGEPGLPGKAGERGLRGAPGPRGPVGEKGNEGDPGEDGRNG
TPGPSGPKGDRGEPGPPGLPGRLVDAALESRDKGEPGQEGPRGPKGDPGPPGASGERGID
GLRGPPGPQGDPGVRGPAGDKGDRGSPGLDGRNGLDGKPGAPGPPGLHGASGKAGDPGRD
GLPGLRGEHGPPGPPGPPGVPGKPGDDGKPGLNGKNGEPGDPGEDGRKGEKGDSGVPGRE
GPDGPKGERGAPGNPGLQGPPGLPGQVGPPGQGFPGVPGVTGPKGDRGETGSKGEQGLPG
ERGLRGEPGSLPNAERFLETAGIKVSALREIVDTWGESSGSFLLVPERRQGPKGDPGDPG
PPGKEGSIGLPGERGLKGERGDPGPQGPPGLALGERGPPGPSGLAGEPGKPGIPGLPGRA
GAAGEAGRPGERGERGEKGERGEQGRDGHPGLPGPPGPPGPKVAIEELGPGPAREQGPPG
LKGAKGEPGSDGVPGPKGDRGVPGIKGDAGEPGKRGPDGNPGLPGERGVSGPEGKPGLQG
PRGTPGPVGSHGDPGPPGAPGLAGPAGPQGPSGLKGEPGETGPPGRGLPGPTGAVGLPGP
PGPSGLVGPQGSPGLPGQVGETGKPGPPGRDGSSGKDGERGGPGVPGLPGLPGPVGPKGE
PGPVGAPGQVVVGPPGAKGEKGAPGDLAGALLGEPGAKGDRGLPGPRGEKGEAGHAGEPG
DPGEDGQKGAPGLKGLKGEPGIGVQGPPGPSGPPGMKGDLGPPGAPGAPGIVGFPGQPGP
RGETGQPGPVGERGLAGPPGREGAPGPLGPPGPPGSVGAPGASGFKGDKGDSGAGLPGPR
GERGEPGLRGEDGHPGQEGPRGLMGPPGSRGERGEKGDPGAAGLKGDKGDSAVIEGPAGP
RGAKGDMGERGPRGIDGDQGPRGESGDPGDKGSKGEPGDKGSAGSTGVRGLTGPKGEPGA
AGIPGEPGAPGKDGAPGFRGDKGDIGFTGPRGLKGERGVKGTCGRDGEKGDKGEAGFPGR
PGLSGKKGDMGDPGIPGQSGAPGKEGLIGPKGDRGFDGQSGPKGDQGEKGERGPPGVGGF
PGPRGNDGSSGPPGPPGSIGPKGPEGLQGQKGERGPPGESVVGAPGAPGTPGERGEQGRP
GPAGPRGEKGEAALTEDDIRGFVRQEMSQHCACQGQFIASGSRPLPGYAADTAGPQLHHV
PVLRVSHVEEEGQVPPEDDDDFSEYSVYSVEDYQDPEVSWDGDAETKGWDHRGSDLCSLP
LDEGSCTAYTLRWYHRAVPGGTACHPFVYGGCKGNANRFGTREACERRCPPQGVHRQNTG
AA
Download sequence
Identical sequences ENSRNOP00000027994 10116.ENSRNOP00000027994

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]