SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028137 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028137
Domain Number 1 Region: 205-544
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 1.7e-102
Family Rap/Ran-GAP 0.000000885
Further Details:      
 
Domain Number 2 Region: 679-759
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000108
Family PDZ domain 0.015
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000028137
Domain Number - Region: 922-1015
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00706
Family Myosin rod fragments 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028137   Gene: ENSRNOG00000020726   Transcript: ENSRNOT00000028137
Sequence length 1040
Comment pep:known chromosome:RGSC3.4:1:208276451:208285639:-1 gene:ENSRNOG00000020726 transcript:ENSRNOT00000028137 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWAGGVGSPRRGMAPAPTDDLFARKLRQPARPPLTPHTFEPRPARGPLLRSGSDAGEVRP
PTPASPRARAHSHEDTSRPAATPTRLFTDPLALLGLPAEEPEPTFPPVLEPRWFAHYDVQ
SLLFDWAPRPRATGSHTESNSGTLALAEDQTTTSDLLLGAPGFVSELGGEGELGLGGPIS
PPVPPALPNASVSVLEEPQTRTTAYSLEHADLGAGYYRKYFYGKEHQNFFGLDEALGPVA
VSLRREEKEGSGGGTLHSYRVIVRTTQLRTLRGTISEDALPPGPPRGLSPRKLLEHVAPR
LSPTCLRLGSASPKVPRTLLTLDEQVLSFQRKVGILYCRAGQGSEEEMYNNQEAGAAFMQ
FLTLLGDVVRLKGFENYRAQLDTKTDSTGTHSLYTTYQDHEIMFHVSTMLPYTPNNQQQL
LRKRHIGNDIVTIVFQEPGSKPFCPTTIRSHFQHVFLVVRAHAPCTPHTSYRVAVSRTQD
TPAFGPALPEGGGPFAANADFRAFLLAKALNGEQAAGHARQFHAMATRTRQQYLQDLATN
EVTTTSLDSASRFGLPSLGGRRRATPRSPGAELQAAGALMWGVRAAPGARVSAGAETGGP
DHAEVPCLLGISAETLVLVTPRDGRVVFNCACRDVLAWTFSDHQLDLYHGRGEAITLRLD
GAPGQAVGEVVARLQLVSRGCETRELALPRDGQGRLGFEVDAEGFITHVERFTFAETTGL
RPGARLLRVCGQTLPKLGPEAAAQMLRSASKVCVTVLPPDESGRPRRSFSELYTLSLKEP
SRRAAPEPEQDETEKLVTLPAAKQLLHFCLKDGGSPPGPGDLTEERTEFLHSHNSLSPRS
SMSDEAPVLPNTTPDLLLVTAVTTLAPGTDRETPPSQDQSGSSSSHEDTSDSAPELRASI
LPRTLSLRNSISKIMSEAGSETLEDEWQSISEIASTCNTILESLSREGQPILESGDPKET
SKCNSEPEPGSLSEKVSHLESMLRKLQEDLQREKADRAALEEEVRSLRHNNQRLLAESES
AATRLLLASKQLGSPTTDLA
Download sequence
Identical sequences E9PSX8
10116.ENSRNOP00000028137 XP_006230911.1.100692 ENSRNOP00000028137 ENSRNOP00000028137

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]