SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028222 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028222
Domain Number 1 Region: 12-58
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 3.81e-19
Family Transcriptional factor domain 0.0013
Further Details:      
 
Domain Number 2 Region: 60-125
Classification Level Classification E-value
Superfamily Zinc beta-ribbon 1.27e-18
Family Transcriptional factor domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028222   Gene: ENSRNOG00000020799   Transcript: ENSRNOT00000028222
Sequence length 125
Comment pep:known chromosome:RGSC3.4:1:85489089:85490526:-1 gene:ENSRNOG00000020799 transcript:ENSRNOT00000028222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPDGTYEPGFVGIRFCQECNNMLYPKEDKENRILLYACRNCDYQQEADNSCIYVNKITH
EVDELTQIIADVSQDPTLPRTEDHPCQKCGHKEAVFFQSHSARAEDAMRLYYVCTAPHCG
HRWTE
Download sequence
Identical sequences A0A091DG46 A0A0A0MV17 A0A0D9QW72 A0A1A6HJE9 A0A1S3ALF1 A0A1S3G0Y0 A0A1U7R6C8 A0A1U7V0V1 A0A212DBI3 A0A250Y9M4 A0A2K5EQS2 A0A2K5KX09 A0A2K5PYM5 A0A2K5ZTE6 A0A2K6FJ27 A0A2K6LT63 A0A2K6RD69 A0A2K6UAF2 D2HFU4 D4A531 E2QYJ4 F1MZ35 F6U7C7 F6ZTX6 F7IC64 G1PKA1 G1RLW6 G1TAL1 G3RHC8 G3TFB9 G5BK10 G7PXC1 H0VKN8 H0XWT9 H2NYJ8 H2QG57 I0FFS3 I3MDG9 L5L2W2 L5LT90 M3X8K0 M3Y2V4 P36954 P60898 P60899 S7MM78 S9X176 W5P5E8
ENSMUSP00000019882 ENSOARP00000005651 ENSPTRP00000018648 ENSMMUP00000000706 ENSCJAP00000017724 ENSOGAP00000020582 ENSP00000221859 ENSCAFP00000009872 ENSETEP00000010279 ENSFCAP00000022952 ENSOCUP00000013715 ENSPVAP00000012150 ENSSARP00000008433 ENSSTOP00000008431 ENSMLUP00000011213 ENSTTRP00000003689 ENSPTRP00000018648 ENSOGAP00000020582 NP_001099714.1.100692 NP_001192333.1.46622 NP_001253556.1.72884 NP_006224.1.87134 NP_006224.1.92137 NP_081535.1.92730 XP_001162834.1.37143 XP_001364276.1.35504 XP_002762104.2.60252 XP_002829145.1.23681 XP_002920967.1.58354 XP_003280122.1.23891 XP_003422351.1.64505 XP_003467274.1.53824 XP_003796169.1.62490 XP_003816187.1.60992 XP_003937444.1.74449 XP_003997961.1.62641 XP_004015228.1.66739 XP_004284241.1.21590 XP_004313421.1.83887 XP_004396508.1.74151 XP_004439793.1.5094 XP_004464937.1.11602 XP_004600782.1.94378 XP_004636812.1.9945 XP_004659999.1.11716 XP_004690609.1.23501 XP_004715870.1.18182 XP_004765214.1.14098 XP_004859030.1.39548 XP_005081885.1.91757 XP_005342003.1.77405 XP_005342004.1.77405 XP_005361316.1.66349 XP_005399979.1.28644 XP_005588992.1.63531 XP_005596244.1.31192 XP_005692329.1.57651 XP_005862463.1.60319 XP_005908282.1.15283 XP_005958294.1.78601 XP_006068823.1.26621 XP_006098691.1.53796 XP_006184490.1.101512 XP_006217095.1.17985 XP_006731491.1.47382 XP_006765106.1.95426 XP_006899719.1.29581 XP_006906008.1.64745 XP_006982087.1.50099 XP_007096877.1.5354 XP_007101160.1.24612 XP_007165248.1.59432 XP_007471090.1.90284 XP_007536970.1.11023 XP_007953059.1.48129 XP_007994662.1.81039 XP_008071831.1.4292 XP_008138065.1.99482 XP_008534463.1.77740 XP_008573876.1.73410 XP_008710397.1.72690 XP_008757487.1.100692 XP_008826293.1.79516 XP_010367107.1.97406 XP_010630186.1.5607 XP_010847355.1.44457 XP_010948431.1.22495 XP_010977168.1.51371 XP_011380141.1.92234 XP_011840204.1.47321 XP_011899085.1.92194 XP_011975959.1.54773 XP_012292953.1.9421 XP_012507008.1.63892 XP_012630417.1.48125 XP_012630418.1.48125 XP_012881722.1.60039 XP_014693799.1.49734 XP_014927500.1.86478 XP_015352719.1.40921 XP_015352720.1.40921 XP_015975221.1.101085 XP_016076464.1.3490 XP_016076465.1.3490 XP_017193656.1.1745 XP_017362163.1.71028 XP_017444702.1.4139 XP_017515571.1.32401 XP_017704163.1.44346 XP_018871162.1.27298 XP_019278787.1.44245 XP_019480460.1.44202 XP_019605534.1.88060 XP_019834730.1.53367 XP_020023790.1.5219 XP_020727457.1.74333 XP_020833526.1.61212 XP_021055710.1.100879 XP_021496676.1.76796 XP_021556567.1.83697 XP_021576884.1.77405 XP_853642.1.84170 ENSCPOP00000010879 ENSLAFP00000013012 ENSRNOP00000028222 ENSBTAP00000019969 ENSDNOP00000012285 GO.41606 ENSLAFP00000013012 ENSECAP00000011342 ENSAMEP00000001043 ENSPANP00000004770 ENSMICP00000009323 5iy6_I 5iy7_I 5iy8_I 5iy9_I 5iya_I 5iyb_I 5iyc_I 5iyd_I 6exv_I 6gmh_I 6gml_I ENSFCAP00000013119 ENSBTAP00000019969 ENSSSCP00000003150 HGL_H00000221859 ENSPVAP00000012150 ENSMODP00000017720 ENSCAFP00000009872 ENSPCAP00000003256 ENSTTRP00000003689 ENSCPOP00000010879 ENSEEUP00000001923 ENSOCUP00000013715 ENSMPUP00000005655 ENSMODP00000017720 ENSETEP00000010279 ENSSARP00000008433 ENSAMEP00000001043 ENSPCAP00000003256 ENSDNOP00000012285 ENSMUSP00000019882 ENSP00000221859 ENSNLEP00000014230 ENSMICP00000009323 ENSRNOP00000028222 ENSRNOP00000067287 ENSMLUP00000011213 ENSMMUP00000000706 ENSEEUP00000001923 10090.ENSMUSP00000019882 10116.ENSRNOP00000028222 10141.ENSCPOP00000010879 13616.ENSMODP00000017720 9361.ENSDNOP00000012285 9544.ENSMMUP00000000706 9598.ENSPTRP00000018648 9600.ENSPPYP00000011079 9606.ENSP00000221859 9615.ENSCAFP00000009872 9685.ENSFCAP00000013119 9796.ENSECAP00000011342 9823.ENSSSCP00000003150 9986.ENSOCUP00000013715 gi|5453930|ref|NP_006224.1| ENSMPUP00000005655 ENSNLEP00000014230 ENSCJAP00000017724 ENSP00000221859 ENSSTOP00000008431 ENSMUSP00000019882 ENSPPYP00000011079 ENSPPYP00000011079 ENSECAP00000011342 ENSSSCP00000003150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]