SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028264 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028264
Domain Number 1 Region: 384-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.73e-49
Family Nucleotide and nucleoside kinases 0.0000867
Further Details:      
 
Domain Number 2 Region: 202-305
Classification Level Classification E-value
Superfamily SH3-domain 3.87e-23
Family SH3-domain 0.0011
Further Details:      
 
Domain Number 3 Region: 132-217
Classification Level Classification E-value
Superfamily PDZ domain-like 4.6e-20
Family PDZ domain 0.0011
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000118
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028264   Gene: ENSRNOG00000033653   Transcript: ENSRNOT00000028264
Sequence length 585
Comment pep:known chromosome:RGSC3.4:10:91057810:91085500:-1 gene:ENSRNOG00000033653 transcript:ENSRNOT00000028264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSGLHETLALLTSQLRPDSNHREEMGFLRDVFSEKSLGYLMKIHEKLRYYERQS
PTPVLHSAMALAEDVMEELQAASVHSDERELLQLLSTPHLRAVLMVHDTVAQKNFDPVLP
PLPDNIDEDFEEESVKIVRLVKNKEPLGATIRRDEHSGAVVVARIMRGGAADRSGLVHVG
DELREVNGITVLHKRPDEISQILAQSQGSITLKIIPATQEEDRFKESKVFMRALFHYDPR
EDRAIPCQEAGLPFQQRQVLEVVSQDDPTWWQAKRVGDTNLRAGLIPSKQFQERRLSYRR
TTGTIPSPQNLRKPLYDQPCDKETCDCDGYFKGHYVAGLRRSFRLGCRERLTGSQEVKVP
VGAESQVLLTYEEVARYQHQPGERSRLVVLIGSLGAHLHELKQRVVAEDPQHFGVAVPHT
TRPRKSHEREGVEYHFVSKQAFEADIQHNKFLEHGEHKENLYGTSLEAIQTVMAKNKVCL
VDVEPEALRHLRTPEFKPYVIFVKPAIQEKRKTPPVSPDSEDPATPLDEQQQEMAASAAF
IDQHYGHLIDTVLVRQDLQSVCSQLRAVIESLSKDTYWVPISWVR
Download sequence
Identical sequences O88954
ENSRNOP00000028264 NP_446120.1.100692 NP_446120.1.4139 XP_008766153.1.100692 XP_008766154.1.100692 10116.ENSRNOP00000028264 ENSRNOP00000028264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]