SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028310 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028310
Domain Number 1 Region: 362-565
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.49e-53
Family Nucleotide and nucleoside kinases 0.0000129
Further Details:      
 
Domain Number 2 Region: 220-352
Classification Level Classification E-value
Superfamily SH3-domain 9.71e-33
Family SH3-domain 0.0013
Further Details:      
 
Domain Number 3 Region: 134-237
Classification Level Classification E-value
Superfamily PDZ domain-like 1.45e-16
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 82-135
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000212
Family L27 domain 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028310   Gene: ENSRNOG00000020850   Transcript: ENSRNOT00000028310
Sequence length 569
Comment pep:known chromosome:RGSC3.4:10:91126327:91153723:-1 gene:ENSRNOG00000020850 transcript:ENSRNOT00000028310 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACSPGSEASLEGISLGSSEEAELRREAMQQVLDNLGSLPNATGAAELDLIFLRGIMESP
IVRSLAKAHERLEETKLEAVRDNNLELVQEILRDLAELAEQSSTAAELARILQEPHFQSL
LETHDSVASKTYETPPPSPGLDPTFSNQPVPPDAVRMVGIRKTAGEHLGVTFRVEGGELV
IARILHGGMVAQQGLLHVGDIIKEVNGQPVGSDPRALQELLRSASGSVILKILPSYQEPH
LPRQVFVKCHFDYDPARDSLIPCKEAGLRFNAGDLLQIVNQDDANWWQACHVEGGSAGLI
PSQLLEEKRKAFVKRDLELTPTSGTLCGSLSGKKKKRMMYLTTKNAEFDRHELLIYEEVA
RMPPFRRKTLVLIGAQGVGRRSLKNKLILWDPDRYGTTVPYTSRRPKDSEREGQGYSFVS
RGEMEADIRAGRYLEHGEYEGNLYGTRIDSIRGVVASGKVCVLDVNPQAVKVLRTAEFVP
YVVFIEAPDFETLRAMNRAALESGVSTKQLTEADLRRTVEESSRIQRGYGHYFDLSLVNS
NLERTFRELQTAMEKLRTEPQWVPVSWVY
Download sequence
Identical sequences XP_008766350.1.100692 ENSRNOP00000028310 10116.ENSRNOP00000052061

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]