SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028389 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028389
Domain Number 1 Region: 152-268
Classification Level Classification E-value
Superfamily PX domain 3.14e-25
Family PX domain 0.0017
Further Details:      
 
Domain Number 2 Region: 37-135
Classification Level Classification E-value
Superfamily PDZ domain-like 1.03e-24
Family PDZ domain 0.0068
Further Details:      
 
Domain Number 3 Region: 272-339
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000321
Family Ubiquitin-related 0.083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028389   Gene: ENSRNOG00000020893   Transcript: ENSRNOT00000028389
Sequence length 526
Comment pep:known chromosome:RGSC3.4:2:189471260:189554249:-1 gene:ENSRNOG00000020893 transcript:ENSRNOT00000028389 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADEDGEGIHPSAPHRNGGGGGGSGLHCAGNGGGGGGGPRVVRIVKSESGYGFNVRGQVS
EGGQLRSINGELYAPLQHVSAVLPGGAADRAGVRKGDRILEVNGVNVEGATHKQVVDLIR
AGEKELILTVLSVPPHEADNLDPSDDSLGQSFYDYTEKQAVPISVPTYKHVEQNGEKFVV
YNVYMAGRQLCSKRYREFAILHQNLKREFANFTFPRLPGKWPFSLSEQQLDARRRGLEEY
LEKVCSIRVIGESDIMQEFLSESDENYNGVSDVELRVALPDGATVTVRVKKNSTTDQVYQ
AIAAKVGMDSTTVNYFALFEVINHSFVRKLAPNEFPHKLYVQNYTSAVPGTCLTIRKWLF
TTEEEVLLNDNDLAVTYFFHQAVDDVKKGYIKAEEKSYQLQKLYEQRKMVMYLNMLRTCE
GYNEIIFPHCACDSRRKGHVITAISITHFKLHACTEEGQLENQVIAFEWDEMQRWDTDEE
GMAFCFEYARGEKKPRWVKIFTPYFNYMHECFERVFCELKWRKEEY
Download sequence
Identical sequences G3V8U4
NP_690060.2.100692 NP_690060.2.4139 10116.ENSRNOP00000028389 ENSRNOP00000028389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]