SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028612 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028612
Domain Number 1 Region: 62-433
Classification Level Classification E-value
Superfamily SAICAR synthase-like 5.23e-124
Family Phosphatidylinositol phosphate kinase IIbeta, PIPK IIbeta 0.00000421
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028612   Gene: ENSRNOG00000021068   Transcript: ENSRNOT00000028612
Sequence length 546
Comment pep:known chromosome:RGSC3.4:2:189962528:190005684:-1 gene:ENSRNOG00000021068 transcript:ENSRNOT00000028612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASASSGPAAAGFSPLDSGVPAGTAASGIKRGTVSEGPYASLMPVKKIGHRSVDSSGETT
YKKTTSSALKGAIQLGITHTVGSLSTKPERDVLMQDFYVVESIFFPSEGSNLTPAHHYND
FRFKTYAPVAFRYFRELFGIRPDDYLYSLCSEPLIELSNSGASGSLFYVSSDDEFIIKTV
QHKEAEFLQKLLPGYYMNLNQNPRTLLPKFYGLYCVQAGGKNIRIVVMNNLLPRSVKMHM
KYDLKGSTYKRRASQKEREKTLPTFKDLDFLQDIPDGLFLDADMYSALCKTLQRDCLVLQ
SFKIMDYSLLMSIHNMDHAQREPMNSETQYSIDTRRPAPQKALYSTAMESIQGEARRGGT
VETEDHMGGIPARNNKGERLLLYIGIIDILQSYRFVKKLEHSWKALVHDGDTVSVHRPGF
YAERFQRFMCNTVFKKIPLKPSPTKKFRSGPSFSRRSGPSGNSCTPSQPTASGEHKAQVT
TKAEVEPDIHLGRPDVLPQTPPLEEISEGSPVPGPSFSPAVGQPLQILNLSSTLEKLDVA
ESELTH
Download sequence
Identical sequences D3ZSI8
10116.ENSRNOP00000028609 ENSRNOP00000028609 ENSRNOP00000028612

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]