SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000028719 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000028719
Domain Number 1 Region: 71-184
Classification Level Classification E-value
Superfamily PDZ domain-like 1.84e-23
Family PDZ domain 0.0042
Further Details:      
 
Domain Number 2 Region: 206-286
Classification Level Classification E-value
Superfamily PDZ domain-like 1.18e-20
Family PDZ domain 0.0001
Further Details:      
 
Domain Number 3 Region: 741-842
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.00000674
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000028719   Gene: ENSRNOG00000021149   Transcript: ENSRNOT00000028719
Sequence length 910
Comment pep:known chromosome:RGSC3.4:1:96720185:96768550:-1 gene:ENSRNOG00000021149 transcript:ENSRNOT00000028719 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDRKVAREFRHKVDFLIENDAEKDYLYDVLRMYHQTMDVAVLVGDLKLVINEPNRLPLFD
AIRPLIPLKHQVEYDQLTPRRSRKLKEVRLDRLHPEGLGLSVRGGLEFGCGLFISHLIKG
GQADSVGLQVGDEIVRINGYSISSCTHEEVINLIRTKKTVSIKVRHIGLIPVKSSPEEPL
KWQYVDQFVSESGGVRGGLSSPGNRTTKEKKVFISLVGSRGLGCSISSGPIQKPGIFVSN
VKPGSLSAEVGLETGDQIVEVNGIDFTNLDHKEAVNVLKSSRSLTISIVAGAGRELFMTD
RERLEEARQHELQRQELLMQKRLAMESNKILQEQQEMERQRRKEIAQKAAEENERYRKEM
EQISEEEEKFKKQWEEDWGSKEQLILPKTITAEVHPVPLRKPKSFGWFYRYDGKFPTIRK
KAKEKKKAKYDSLQDLRKNKKELEFEQKLYKEKEEMLEKEKQLKINRLAQEVSETEREDL
EESEKTQYWVERLCQTRLQQISSAENEITEMTTGPPPPPPSVSPLVPPLRRFAGGIHLHT
TDLDDIPLDMFYYPPKTPSALPVMPHPPPSNPPSKVPAPPVLPSSDHMSSSSSPWVQHTP
PPIPIPPPPSIPTQDLTPTRPLPSALEEVLGNHPFRTGDPGHPATDWEANTHSGKPTSSP
TPERSFPPAPKTFCPSPQPPRGPGVSTISKPVMVHQEHNFVYRPAVKSEVLPQEMLKRMV
VYQTAFRQDFRKYEEGFDPYSMFSPEQIAGKDVRLLRIKKEGSLDLALEGGVDSPVGKVV
VSAVYEGGAAERHGGVVKGDEIMAINGKIVTDYTLAEAEAALQKAWNQGGDWIDLVVAVC
PPKEYDDELSSLPSSAAESPQPVRKQLEAYEPVCRHGFFLQLEPTNLLLKSRDRSQPDPS
WKLASSAPSP
Download sequence
Identical sequences ENSRNOP00000028719 XP_006229284.1.100692 10116.ENSRNOP00000028717

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]