SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000029044 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000029044
Domain Number 1 Region: 4-105
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.93e-23
Family Ras-binding domain, RBD 0.012
Further Details:      
 
Domain Number 2 Region: 950-1046
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-22
Family PDZ domain 0.0000282
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000029044
Domain Number - Region: 1317-1418
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0759
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000029044   Gene: ENSRNOG00000023753   Transcript: ENSRNOT00000032667
Sequence length 1772
Comment pep:known chromosome:RGSC3.4:1:48827689:48913175:1 gene:ENSRNOG00000023753 transcript:ENSRNOT00000032667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DLEFHGVMRFYFQDKAAGNFATKCIRVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYE
VHVSGEERRLDIDEKPLVVQLNWNKDDREGRFVLKNENDAIPAKKAQSNGPEKQEKEGVI
QNFKRTLSKKEKKEKKKREKEALRQASDKEERPSQGDDRANLSQLLVTGGTVTETVMSAL
LWKPEALQGNWRAQNWQTRQQGRFSFSNSNVPWTFMFCGSSLMVDHPPKVILGLLVNSSK
WTVTKEMEHILEMRHFHSHCMARKLLEQYTYESLTSGKFTIILSKDFHPLQLFPFCPSRV
YGIVCVCFKRHVPELIPPYMAAFLASVAVQGNAGQRAQGSPALFPSKYLYIVNLALPRKS
WSHLRSRLHRLSMYVTVEVGFEASDEVNIHLLGSTFFPWPCWLLNHEGIMENRLRNLNYP
SYLQGHKVPEVFLFPSSLFFFFFLSEPMTFIKPISQHFLASAIVTGFGGCTWDKSRGGAV
SGRTFLQSLIHSLSLLPSFFHKTGLQVQRFGPLSSRWEHGRVQVLIVSQKERVFEVFSFR
TQDAAGPELMLPASIEFRESSEDSFLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSSQH
RPDISPTERTHKAIAVVNKMVSMMEGVIQKQKNIAGALAFWMANASELLNFIKQDRDLSR
ITLDAQDVLAHLVQMAFKYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAM
SLLRRCRVNAALTIQLFSQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWA
EKQGLELAADCHLSRIVQATTLLTMDKYVPDDIPNINSTCFKLNSLQLQALLQNYHCAPD
EPFIPTDLIENVVAVAENTADELARSDGRDVQLEEDPDLQLPFLLPEDGYSCDVVRNIPN
GLQEFLDPLCQRGFCRLVPHTRSPGTWTIYFEGADYESHLMRENTELTQPLRKEPEVITV
TLKKQNGMGLSIVAAKGAGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLS
QERAAELMTRTSSVVTLEVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFE
LYNNSAQNGSPESPQMPWTEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSPYT
SGTAAKITSVSTGNLCTEEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPVQNQWP
NYEEKPHMHTESDHASIAIQRVTRSQEELREEKVYQLERHRVESGMDRKCDSDMWINQSS
SVESSTSSQEHLNHSSKSVTPASTLTKSGPGRWKTPAAVLPTPVAVSQPIRTDLPPPPPP
PPAHYTSDFDGISMDLPLPPPPANQAAPQSAQVAAAERKKREEHQRWYEKEKARLEEERE
RKRREQERKLGQMRTQSLNPASFSPLATQAKPEKPSTLQRPQETVIRELQPQQQPRTIER
RDLQYITISKEELSSGDSLSPDPWKRDAREKLEKQQQMHIVDMLSKEIHELQNKGDRTAE
ESDRLRKLMLEWQFQKRLQESKQKDEDDDEEEDDDVDTMLIMQRLEAERRARLQDEERRR
QQQLEEMRKREVEDRVRQEEDGRHQEEERVKRDAEEKRRQEEGYYSRLEAERRRQHEEAA
RRLLEPEEPGLSRPPLPQDYEPPSQSSAPSAPPPPPQRNASYLKTQVLSPDSLFTAKFVA
YDDDDEEENYVPAGPNSYSGSAGTTAGTYDAPRDTREKLSRSQDADLPGSSGAPENLTFR
ERQRLFSQGQDVSDKVKASRKLTELENELNTK
Download sequence
Identical sequences 10116.ENSRNOP00000029044 ENSRNOP00000029044

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]