SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030076 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030076
Domain Number 1 Region: 147-344
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-57
Family Prokaryotic proteases 0.0000000175
Further Details:      
 
Domain Number 2 Region: 359-455
Classification Level Classification E-value
Superfamily PDZ domain-like 9.2e-23
Family HtrA-like serine proteases 0.000014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030076   Gene: ENSRNOG00000022448   Transcript: ENSRNOT00000037333
Sequence length 458
Comment pep:known chromosome:RGSC3.4:4:117262208:117265368:-1 gene:ENSRNOG00000022448 transcript:ENSRNOT00000037333 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAALKAGRGANWSLRAWRALGGIFWRKGPLLAPDLRALLTSGTPDPQARMTYGTPSLPAR
VPLGVLASRANLTSGTPDLWVRLTVGTPGSSDQEDCGSPGSRRREWLAVALGAGGAVLLL
LWGWGRGPSTVLAAVPAPPPTSPRSQYNFIADVVEKTAPAVVYIEILDRHPFSGREVPIS
NGSGFIVASDGLIVTNAHVVADRRRVRVRLPSGDTYEAMVTAVDPVADIATLRIQTKEPL
PTLPLGRSADVRQGEFVVAMGSPFALQNTITSGIVSSAQRPARDLGLPQTNVEYIQTDAA
IDFGNSGGPLVNLDGEVIGVNTMKVTAGISFAIPSDRLREFLHRGEKKNSWFGISGSQRR
YIGVMMLTLTPSILAELQLREPSFPDVQHGVLIHKVILGSPAHRAGLRPADVILAIGEKM
IQNAEDVYEAVRTQSQLAVRIRRGPETLTLYVTPEVTE
Download sequence
Identical sequences B0BNB9
10116.ENSRNOP00000030076 ENSRNOP00000030076 ENSRNOP00000030076 NP_001100069.1.100692 NP_001100069.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]