SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030169 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030169
Domain Number 1 Region: 643-706
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000000000000795
Family Regulator of G-protein signaling, RGS 0.0081
Further Details:      
 
Domain Number 2 Region: 877-983
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.00000604
Family Regulator of G-protein signaling, RGS 0.012
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000030169
Domain Number - Region: 372-492
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.000124
Family Regulator of G-protein signaling, RGS 0.0056
Further Details:      
 
Domain Number - Region: 90-195
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 0.0177
Family Regulator of G-protein signaling, RGS 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030169   Gene: ENSRNOG00000026952   Transcript: ENSRNOT00000029773
Sequence length 1034
Comment pep:known chromosome:RGSC3.4:13:68841149:68900797:-1 gene:ENSRNOG00000026952 transcript:ENSRNOT00000029773 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SPYVEIICSTNLIILLEDETFADFFNTFLSLPVFGQTPFYNVELSQWSLWPEIPYDLITK
YKGLLTWLEKYRLPFFCKTNLCFYYILCQELISFVKSPEGGEELLDFWVLAEKILSIDET
DEYLKDYYLSLLLVLKATHLQEGSRVVTLCNMDIKSLLNLSIWHPNQSTTRREILSHMQK
VALFKIQSYWLPNFYTHAKMTMANEEACHGLLQEYETRLCSVCCTHAGGLPLNMSIKKSH
RSQKKYSSKKAKKKMWHLNNPIFWPLETDPKPEVPTKAPEEMSLPERVVLQKPSLGEDSS
KETVVHPLCKDLQNAKKPIVKKKSKIQLHMEGLLETTFSNHLRTSTPMINHAAPLVVKKS
LKRSLSFGYTHWALCADACAGSPFRYHLKKMNLKAEVQLLDLWQDLQHFVSVLMTNRQNG
NALFRHVLGNRICELYLNEQIGPPLPLKPQTLQGLKKLLPSGEVNPWIPKAQREICKMLS
SRYDEFLMEEDYWFLVFTTQTRFIKARWYKREAINKEEHVLLYKRLQESLLLSQALANIQ
EIDSIQWQKVATENLRQGGSLQVELTTPVFLQDTSKMSFKDLSFKNPKLAIEKMSEDYKI
YCERVPPTDFTVEIIKQPRVSYSQRKISFAKRSVIRKPSMRPRNMTEILLNNAHLEYFRE
FLKDRKSENPLQFLIAVQKIMMETNEKTYKTSLENITKTYLHGKVPPGRKELICLVPVCR
ELSSIFLHFSTETLTKCSFEALKSHIEQRFKEYQDLFPPRPVEVEPVETHVVPRKPSKTI
TTHLHDSQKRGWIKMISFIKSFCKYRRFVTNAKNLQELTDFIYLEMYNNKENFSSSPTPS
ARHTPIYPSARNTEPENGEIALVKRRIFGHRIITINFAVNDIYFFSEMEKFNDLVTSAHM
LQVNKAYNENDIVLMRSKLNIILKLYLISDLPPKLRVNISESQKDIIFSAITEGHLDRTI
FHGAIMSVFPVVMYFWKRFCSWKATRSYIEYIGKKFEDGRNPPKSVYKYPPWSGGDHTVL
RFSLLRGIEWFRPQ
Download sequence
Identical sequences 10116.ENSRNOP00000030169 ENSRNOP00000030169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]