SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030437 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030437
Domain Number 1 Region: 1-82
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.14e-27
Family Ribosomal L11/L12e N-terminal domain 0.0000183
Further Details:      
 
Domain Number 2 Region: 71-144
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.22e-17
Family Ribosomal protein L11, C-terminal domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030437   Gene: ENSRNOG00000025014   Transcript: ENSRNOT00000030686
Sequence length 157
Comment pep:known chromosome:RGSC3.4:11:82399041:82399514:1 gene:ENSRNOG00000025014 transcript:ENSRNOT00000030686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPNEIKVVYLRCTRDEVRATSALAPKIGPLRLSPKKVGDDIAKTTGDWKGLRITVKLTI
QNRQAQIEVVPSASALIIKALKEPPRDRKKQKNIKHSGNITFDEIVNIAGQMRHQSLARE
LSGTIKEILGTAQSVGCNVDGRHPHDINSGAVECPAS
Download sequence
Identical sequences ENSRNOP00000030437 10116.ENSRNOP00000030437

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]