SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030776 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030776
Domain Number 1 Region: 21-75,223-361,398-444
Classification Level Classification E-value
Superfamily SAICAR synthase-like 3.92e-72
Family Inositol polyphosphate kinase (IPK) 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030776   Gene: ENSRNOG00000020361   Transcript: ENSRNOT00000030288
Sequence length 448
Comment pep:known chromosome:RGSC3.4:8:113851194:113853005:1 gene:ENSRNOG00000020361 transcript:ENSRNOT00000030288 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPAFRTMDVEPRTKGILLEPFVHQVGGHSCVLRFNETTLCKPLVPREHQFYETLPAEMR
RFTPQYKAVLIFVRFADEFGASGNIETKEQGVVSVRFEEDEDRNLCLIAYPLKGDHGPVD
IVDNSDCEPKSKLLRWTNKKHHVLETEKSPKDWVRQHRKEEKMKSHKLEEEFEWLKKSEV
LYYSVEKKGTVSSQLKHYNPWSMKCHQQQLQRMKENAKHRNQYKFILLENLTCRYEVPCV
LDLKMGTRQHGDDASEEKAANQIRKCQQSTSAVIGVRVCGMQVYQAGTGQLMFMNKYHGR
KLSVQGFKEALFQFFHNGRYLRRELLGPVLKKLTELKAVLERQESYRFYSSSLLVIYDGK
EWPEVTLDSDAEDLEDLSEESADESAGAYAYKPLGASSVDVRMIDFAHTTCRLYGEDSVV
HEGQDAGYIFGLQSLIDIVTEISEESGE
Download sequence
Identical sequences 10116.ENSRNOP00000039425 ENSRNOP00000030776 XP_008764788.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]