SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000030935 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000030935
Domain Number 1 Region: 549-739,832-1153
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 6.39e-69
Family Tandem AAA-ATPase domain 0.039
Further Details:      
 
Domain Number 2 Region: 168-224
Classification Level Classification E-value
Superfamily UBA-like 0.0000000851
Family UBA domain 0.033
Further Details:      
 
Domain Number 3 Region: 303-327
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00000759
Family CCCH zinc finger 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000030935
Domain Number - Region: 243-325,358-421
Classification Level Classification E-value
Superfamily UBC-like 0.00505
Family UBC-related 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000030935   Gene: ENSRNOG00000027329   Transcript: ENSRNOT00000037705
Sequence length 1391
Comment pep:known chromosome:RGSC3.4:6:3139950:3183171:-1 gene:ENSRNOG00000027329 transcript:ENSRNOT00000037705 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSSVRRKGKPGKGDGKGSSRGGRGGRGHVNKSHGGGGSGGGGCGGGGGGGSGSRKASNR
IWDDGDDFCVFTESKRPSRPCDSNKSKGETRPKWKPKAKVPLQTLHMTSENQEKVKALLR
DLQEQGADAGSERGSSGEEEEDAPEGAAEQSWSAGPEPTFLPDCRPWEYIGPEEVEPPLP
EFTVSPLAVQKLSRYGFHTEHCQLALRICEGDLGAALEHLLHQCFSETFGERMALSEAAV
SVSLDECVEQRQEETLALKSICGEKFIERIQNRVWTIGLELEYLTNKFCKSKQKESNKNV
RDTSPETCKFYLKGNCKFGSKCKFKHEVPPHQIIGRTERNVNDPHLDAENDTTFLYELQI
RFSKDHKYPYQAPLVAFYSTNENLPLACRLHISEFLYGKALEFAKTSEPVVYSLITLLEE
ESEIVKLLTHTQHKYSVPPINVPPAPSETRISKPAYRKPVIPSNTFLSNQMLEGEGLSEL
EEDADEDEGPAPIVVENESYVNLKKRSYRRCDRPAKSLFAENSKICRQFQMKQASRQFHA
ILQERQLLPAWEERETILKLLSKHQVVVISGMTGCGKTTQIPQFILDNSLNGPPERVANI
ICTQPRRISAISVAERVAKERAERVGLTVGYQIRLESVKSSATRLLYCTTGVLLRRLEGD
ATLQGVTHIIVDEVHERTEESDFLLLVLKDIVMQRATLQVILMSATLDAGLFSKYFSYCP
VITIPGRAFPVDQFFLEDALAVTRYVLQDGSPYMRSMKQIAKERLKARHNRTALEEVEED
LRLALHLQDEEESVKDTIPDQQLDFKQLLVRYKGVSKSVIKTMSVMDFEKVNLELIEALL
EWIVDGKHSYPPGAILVFLPGLAEIKMLYEQLQSNSLFNNRRSHRCVIHPLHSSLSSEEQ
QAVFVKPPLGVTKIIISTNIAETSITIDDVVYVIDSGKMKEKRYDAGKGMESLEDTFVSQ
ANALQRKGRAGRVASGVCFHLFTSHHYNHQLLKQQLPEIQRVPLEQLCLRIKILEMFSTH
NLQSVFSRLIEPPHVDSLRASKVRLRDLGALTPDEKLTPLGYHLASLPVDVRIGKLMLLG
SIFRCLDPALTIAASLAFKSPFVSPWDKKEEANQKKLEFAFANSDYLALLCAYKGWQLST
KESARASYNYCRQNFLSGRTLQEMASLKRQFTELLSDIGFVKEGLRAKEIEKRAQGGDGV
LDATGEEANTNAENPKLISAVLCAALYPNVVQVKTPEGKFQKTSSGVVRLQPKSAELKFV
TKNDGYVHIHPSSVNYQVRHFDSPYLLYHEKIKTSRVFIRDCSMVSVYPLVLFGGGQVSV
QLQRGAFVVSLDDGWIRFVAASHQVAELVKELRCELDQLLQDKIKNPSMDLCTCPRGSRI
ISMIVKLITTQ
Download sequence
Identical sequences ENSRNOP00000030935 ENSRNOP00000030935 NP_001178836.1.100692 NP_001178836.1.4139 10116.ENSRNOP00000030935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]