SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000031087 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000031087
Domain Number 1 Region: 486-830
Classification Level Classification E-value
Superfamily Rap/Ran-GAP 2.75e-116
Family Rap/Ran-GAP 0.00000048
Further Details:      
 
Domain Number 2 Region: 955-1035
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000836
Family PDZ domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000031087   Gene: ENSRNOG00000020703   Transcript: ENSRNOT00000038929
Sequence length 1776
Comment pep:known chromosome:RGSC3.4:1:84456423:84540351:-1 gene:ENSRNOG00000020703 transcript:ENSRNOT00000038929 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYRPLPNDGVDLATSCGARSTDILPGPHPGDYTPMGFWAQNGSMSQPLGESPATATTR
PSPTTPAMPKMGVRARVADWPPKRDALREQSNPSPSQDTDGVKTTKVAHSMRNLQNGQLP
SSTPASSGSRAFHRLSRRRSKDVEFQDGWPRSPGRAFLPLRHRSSSEITLSECDVEEPGD
PRGTRHPGVLPLFREYGSTSSIDVQGVPEQSFFDILNEFRSEQPEARGSQNLSELLRVDP
GALSGGSCGAKGDPRNGQPTKDSLQSLQPLKEKEKARKKPVRGLGSGDTVDSSIFRKLRS
SKPEGEVGRPLGETEEGRSPPEASRPWVCQKSFAHFDVQSMLFDLNEAAANRVSVAQRRN
TTTGASAASAASAMVALTASRAHSLGTLDPTFTSTEDLNCKENLEQDLGDDNSNDLLLSC
PHFRNEIGGERERNVSFSRASVGSPGGSSEAHMAEPALSTHRTNASISVLEVPKEQQRTQ
SRPRQYSIEHVDLGARYYQDYFVGKEHANYFGVDEKLGPVAVSIKREKLEDHKDHGPQYQ
YRIIFRTRELITLRGSILEDATPTATKHGTGRGLPLKDALEYVIPELNIHCLRLALNTPK
VTEQLLKLDEQGLCRKHKVGILYCKAGQSSEEEMYNNEEAGPAFEEFLDLLGDKVCLKGF
TKYAAQLDVKTDSTGTHSLYTTYQDYEIMFHVSTLLPYTPNNRQQLLRKRHIGNDIVTII
FQEPGALPFTPKNIRSHFQHVFIIVRVHNPCTENVCYSMAVTRSKDAPPFGPPIPNGTTF
RKSDVFRDFLLAKVINAENAAHKSDKFHTMATRTRQEYLKDLAENCVSNTPIDSSGKFNL
ISLTSKKKEKTKARAGAEQHSAGAVAWRVAAQDYAQGSEIDCILGISNEFVVLLDLRTKE
VVFNCYCGDVIGWTPDSSTIKIFYGRGDHIFLQAAEGSVEDIRDIVQRLKVMTNGWETVD
MTLRRNGLGQLGFHVKYDGTVAEVEDYGFAWQAGLRQGSRLVEICKVAVVTLSHDQMIDL
LRTSVTVKVVIIPPFEDGTPRRGWPETYDMSTSEPKMESEAATPGGRPPYRSNAPWQWSG
PASHNSLPATKWTTPATPGHAQSLSRLPKHTPGVPFRESQPLHSKRPVSFPETPFAASPA
GADRVPPYRQPSGSFSTPGSATYARYKPSPERYAAAPHPLLSFDPHFIHDGMSSGDSSSG
GLTSQESTMERPKPEPLWHVPAQARLSAMTGSMGSKHPSRQDAAGKDSPNRHSKGEPQYS
SHSSSNTLSSNASSSHSDDRWFDPLDPLEPEPDPFSKGGSSDSGIDTTLYTSSPSCMSLA
KTPRPTKPHKPPGSIGLCGGGRESAGRPHPADRRREVSPAPAVAAQNKGYRPKMYSSGSS
TPPGLVGGSRDPPRQASDMGSRTGYPTQVYKTTSAETPRPSQLSQCSPFQLSTSVPKSFF
SKQPAHNKHSTGWKRADEPPPRPLPFTESKKQVDTNAKNVFGQPRLRASLRDLRSPRKNY
KSTIEDDLKKLIIMDNLGPEQDRDTGQSPQKSLQRTLSDESLCSGRREPSYASPTSLEPG
LPSDVLFTSTCTFPSSTLPARRQHQHSHPPSGAPNTIPATGNGFPEKKSAISASELSLAD
GRDRPLRRLDPGMMPLPDTAAGLEWSSLVNAAKAYEVQRAVSLFSLNDPALSPDIPPAHS
PVHSHLSLERGPQTPRTTPTMSEESPLDLTGKVYQLEVMLKQLHTDLQKEKQDKVVLQSE
VASLRQNNQRLQEESQAASEQLRKFAELFSREKKEL
Download sequence
Identical sequences F1LYG2
XP_008757352.1.100692 XP_017444400.1.100692 ENSRNOP00000031087 10116.ENSRNOP00000031087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]