SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032136 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032136
Domain Number 1 Region: 25-101
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.00000000000000785
Family Ribosomal L11/L12e N-terminal domain 0.0001
Further Details:      
 
Domain Number 2 Region: 98-143
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 0.0000196
Family Ribosomal protein L11, C-terminal domain 0.0087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032136   Gene: ENSRNOG00000024321   Transcript: ENSRNOT00000033403
Sequence length 160
Comment pep:known chromosome:RGSC3.4:10:107243068:107243581:-1 gene:ENSRNOG00000024321 transcript:ENSRNOT00000033403 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SAKEEAMVQLLRSSRIQVHPTPATSTMLHKADPKIKAMHLRCTGGRATSALPKIGPPGLS
PKKKATGDWKGLMVTVKLTIQNRQAQPEVVPSAPALALKELRDRRKQNIKHTGNIAFDEI
VNTAPQILGTAPSVGCTVDGCQPHDIIEGINGGALECSAS
Download sequence
Identical sequences 10116.ENSRNOP00000032136 ENSRNOP00000032136

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]