SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032233 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032233
Domain Number 1 Region: 305-415
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000177
Family Pleckstrin-homology domain (PH domain) 0.034
Further Details:      
 
Weak hits

Sequence:  ENSRNOP00000032233
Domain Number - Region: 39-91
Classification Level Classification E-value
Superfamily HR1 repeat 0.00288
Family HR1 repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032233   Gene: ENSRNOG00000009022   Transcript: ENSRNOT00000031964
Sequence length 561
Comment pep:known chromosome:RGSC3.4:4:117348330:117363967:1 gene:ENSRNOG00000009022 transcript:ENSRNOT00000031964 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFSRNHRSRVTVARGSALEMEFKRGRFRLSVLSDLPEDTELQRKLDHEIRMREGACKLLA
ACSQREQALEATKSLLVCNSRILSYMGELQRRKEAQVLGKTGRRPSDSVQPPERSPCRGR
VCISDLRIPLMWKDTEYFKNKGDLHRWAVFLLLQLGEQIQDTEMVLVDRTLTDISFQNNA
IFAEAGPDFELRLELYGACVEEEGALAGAPKRLATKLSSSLGRSSGKRVRASLDSAGGSG
NSPILLPTPAVGGPRYHLLAHTTLTLAAVQDGFRTHDLTLTSHEENPAWLPLYGSMCCRL
VAQPLCMTQPTASGTLRVQQAGELQSGTLVHGVLKGTNLFCYWRSEDADSGQEPLFTILI
NKETRVRAGELEQAPEWPFTLSISNRYGDDEVTNTLQVQSRDALQSWMEALWQLFLDMSQ
WKHCCDEVMKIETPAPRKPPQALAKQGSLYHEMAIEPLEDIAAVTDILAQREGTRLEPPP
PWLAMFTDQPALRSSCSPASVPTWTQPLPWGRPRTFSLDAVPADHSLGPSRSVAPLPPQR
SPQSRGFYSKSQLSTWLQSPV
Download sequence
Identical sequences ENSRNOP00000032233 XP_008761257.1.100692 XP_008761276.1.100692 XP_017458303.1.4139 10116.ENSRNOP00000012337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]