SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032265 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032265
Domain Number 1 Region: 2-158
Classification Level Classification E-value
Superfamily UBC-like 4.13e-52
Family UBC-related 0.000000141
Further Details:      
 
Domain Number 2 Region: 157-198
Classification Level Classification E-value
Superfamily UBA-like 1.37e-22
Family UBA domain 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032265   Gene: ENSRNOG00000027088   Transcript: ENSRNOT00000030485
Sequence length 200
Comment pep:known chromosome:RGSC3.4:14:45349287:45411823:-1 gene:ENSRNOG00000027088 transcript:ENSRNOT00000030485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANIAVQRIKREFKEVLKSEETSKNQIKVDLVDENFTELRGEIAGPPDTPYEGGRYQLEI
KIPETYPFNPPKVRFITKIWHPNISSVTGAICLDILKDQWAAAMTLRTVLLSLQALLAAA
EPDDPQDAVVANQYKQNPEMFKQTARLWAHVYAGAPVSSPEYTKKIENLCAMGFDRNAVI
VALSSKSWDVETATELLLSN
Download sequence
Identical sequences A0A096N3L7 A0A0D9RWM0 A0A0N8EU45 A0A151PAY0 A0A1S2ZZJ5 A0A1S3EJE0 A0A1V4JFR7 A0A218ULS6 A0A250XW19 A0A286XLR5 A0A287D018 A0A2I2UNS7 A0A2K5CA84 A0A2K5JDT8 A0A2K5M3H3 A0A2K5R3X8 A0A2K5Y3X8 A0A2K6FJ26 A0A2K6PAJ0 A0A2K6UUG6 A9LM11 D3ZXS8 E2R6W9 F6UEX6 F7DTQ9 G1L8Q9 G1SPV0 G2HEI6 G3IBF7 G3QL63 G3SZH9 G7P5F9 H2PD51 K7FGV0 K9IWQ1 P61085 P61086 P61087 Q06AB2 Q6ZWQ6 U3K3L8 U6CPT6
ENSDNOP00000015380 ENSCPOP00000013335 ENSPTRP00000027533 ENSGGOP00000003207 10090.ENSMUSP00000122471 10116.ENSRNOP00000032265 10141.ENSCPOP00000013335 9361.ENSDNOP00000015380 9544.ENSMMUP00000014859 9598.ENSPTRP00000027533 9600.ENSPPYP00000016399 9606.ENSP00000261427 9615.ENSCAFP00000023490 9796.ENSECAP00000012212 9823.ENSSSCP00000009369 9913.ENSBTAP00000026871 9986.ENSOCUP00000005089 ENSFCAP00000025065 ENSPSIP00000007260 Hs4885417___KOG0418 ENSAMEP00000003277 ENSBTAP00000026871 ENSAMEP00000003278 ENSPSIP00000007260 ENSGGOP00000003207 ENSMMUP00000014859 ENSRNOP00000032265 ENSMUSP00000122471 ENSP00000261427 ENSECAP00000012212 NP_001072139.1.46622 NP_001099476.1.100692 NP_001099476.1.4139 NP_001233454.1.37143 NP_001247770.1.72884 NP_001272586.1.57651 NP_005330.1.87134 NP_005330.1.92137 NP_058066.2.92730 XP_002709441.1.1745 XP_002814730.1.23681 XP_002925212.1.58354 XP_003434442.1.84170 XP_003471677.1.53824 XP_003512281.1.69978 XP_003800735.1.62490 XP_003832239.1.60992 XP_003941038.1.74449 XP_003985474.1.62641 XP_004038621.1.27298 XP_004266296.1.21590 XP_004384718.1.4749 XP_004419050.1.5094 XP_004475521.1.11602 XP_004579201.1.84141 XP_004642700.1.9945 XP_004681395.1.23501 XP_004703215.1.18182 XP_004849880.1.39548 XP_005045403.1.66865 XP_005149178.1.78019 XP_005243254.1.75256 XP_005286422.1.60341 XP_005319985.1.77405 XP_005359329.1.66349 XP_005490571.1.73095 XP_005517821.1.90289 XP_005608872.1.31192 XP_005877511.1.60319 XP_005902052.1.15283 XP_005956606.1.78601 XP_006129563.1.96668 XP_006209822.1.17985 XP_006258537.1.47583 XP_006732380.1.47382 XP_006873282.1.41390 XP_006895460.1.29581 XP_006922509.1.64745 XP_006974672.1.50099 XP_007098942.1.5354 XP_007178866.1.59432 XP_007447989.1.90284 XP_007496606.1.35504 XP_007527046.1.11023 XP_007945331.1.48129 XP_008015791.1.81039 XP_008138454.1.99482 XP_008531093.1.77740 XP_008564149.1.73410 XP_009278418.1.47732 XP_010382849.1.97406 XP_010572751.1.12557 XP_010589727.1.64505 XP_010831866.1.44457 XP_010960956.1.22495 XP_010978680.1.51371 XP_011361050.1.92234 XP_011580946.1.59079 XP_011804475.1.43180 XP_011838954.1.47321 XP_011913291.1.92194 XP_011989066.1.54773 XP_012330378.1.9421 XP_012499956.1.63892 XP_012609422.1.48125 XP_012864503.1.60039 XP_013373506.1.28644 XP_014712700.1.49734 XP_014726537.1.99236 XP_014813267.1.91963 XP_015273853.1.55130 XP_015337536.1.40921 XP_015479667.1.82291 XP_015848929.1.50099 XP_015975439.1.101085 XP_016062082.1.3490 XP_017382734.1.71028 XP_017517948.1.32401 XP_017673077.1.3805 XP_019269374.1.44245 XP_019408392.1.79039 XP_019496386.1.44202 XP_019607480.1.88060 XP_019818171.1.53367 XP_020641856.1.8467 XP_020734639.1.74333 XP_020847055.1.61212 XP_021066161.1.100879 XP_021388868.1.53032 XP_021514383.1.76796 XP_021557276.1.83697 ENSOCUP00000005089 ENSSSCP00000024357 ENSOPRP00000009204 ENSCAFP00000023490 ENSBTAP00000026871 ENSPPYP00000016399 gi|4885417|ref|NP_005330.1| ENSP00000261427 ENSP00000261427 ENSPTRP00000027533 ENSSSCP00000024357 ENSOPRP00000009204 ENSSTOP00000011153 ENSMMUP00000014859 ENSCPOP00000013335 ENSLAFP00000006025 ENSCAFP00000023490 ENSMUSP00000031105 ENSPPYP00000016399 ENSSTOP00000011153 ENSRNOP00000032265 ENSOCUP00000005089 ENSFALP00000009622 ENSECAP00000012212 ENSMUSP00000122471

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]