SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032436 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032436
Domain Number 1 Region: 885-1080
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.39e-56
Family BCR-homology GTPase activation domain (BH-domain) 0.0000324
Further Details:      
 
Domain Number 2 Region: 673-806
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-26
Family Pleckstrin-homology domain (PH domain) 0.0000311
Further Details:      
 
Domain Number 3 Region: 6-38,68-141
Classification Level Classification E-value
Superfamily PDZ domain-like 2.37e-20
Family PDZ domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032436   Gene: ENSRNOG00000022771   Transcript: ENSRNOT00000034305
Sequence length 1461
Comment pep:known chromosome:RGSC3.4:10:86185918:86247752:1 gene:ENSRNOG00000022771 transcript:ENSRNOT00000034305 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QLPLGSRDGCSSGRPLPWQGPRTLLLHKNLQDGFGFTLRHFIVYPPESAVHCSLKEESWG
RAGGRGGGGGPSPRHRLEPMDTIFVKNVKEGGPAHRAGLRTGDRLVKVNGESVIGKTYSQ
VIGLIQNSDDTLELSIMPKDEDILQLAYSQDAYLKGNEPYSGEARSIPEPPPLCYPRKTY
APPTRAPAWATMVPEPISALPTDPRSPAAWSDPGSRVTSATRAHLDNSSLGMSQPRPSPG
AFPHLPSESRTPRAFLESGSRVLPSRLECQQALSHWLSNQIPRRAGERRCPAMPPRARSA
SQDRLEDVTTHHPWPCSTSQDALSQLGQEGWHRARSDDYLSRATRSAEALGPGALVSPRL
ERCGWASQRSSARTSACPSRDLPGPQAPPASGLQGLDDIGYIGYRSYSPSFQRRTGLLHA
LSFRDSPFGGLPTFSLAQSPASFPPEASEPPRVARPDPSTRALEPPAEDHRDEVVLRQKP
PTGRKVQLTPARQVNLGFGDESLEPEARGERPGRKVAPLATTEDSLASIPFIDEPTSPSI
DLQAKHVPASAVVSSAMNSAPVLGTSPSSPTFTFALSRHYSQDCSSIKAGRRSSYLLAIT
TERSKSCDDGLNTFRDEGRVLRRLPNRVPSLRMLRSFFTDGSLDSWGTSEDAEAPSKRHS
TSDLSDATFSDIRREGWLYYKQILTKKGKKAGGGLRQWKRVYAVLRARSLSLSKERREPG
PAAAGAAAAGAGEDEAAPVCIGSCLVDISYSETKRRHVFRLTTADFCEYLFQAEDRDDML
GWIRAIRENSRAEGEDPGCANQALISKKLNDYRKVSHSSGPKADSSPKGSRGLGGLKSEF
LKQTAVRGLRTQDQPAGSKEDSVTTPKTPWGINIIKKNKKAAPRAFGIRLEDCQPATENQ
RVPLIVAACCRIVEARGLESTGIYRVPGNNAVVSSLQEQLNRGPSDINLQDERWQDLNVI
SSLLKAFFRKLPEPLFTDDKYNDFIEANRIEDSRERMKTLRKLIRDLPGHYYETLKFLVG
HLKTIADHSEKNKMEPRNLALVFGPTLVRTSEDNMTDMVTHMPDRYKIVETLIQHSDWFF
SDDEDKGERTPVDDKEPQSVPNIEYLLPNIGRTVPPSDPGSDSTTCSSAKSKGSWVPKKE
PYAREMLAISFISAVNRKRKKRREARGLGSSTDDDSEQEAHKAAVGTQEPPEGQLPGPSA
EEAPGRLSPSTAPDERPAADTRSIVSGYSTLSTMDRSVCSGTGGRRAGAGDEADDERSEL
SHVETDTEGGAGPGGRLARRPSFSSHHLMPCDTLARRRLSRSRADAEGPRGPEPLGSASS
SSQESLRPPAAAPVLGSRPSRVEALRLRLRGTADDMLAVRLRRPLSPETRRRRSSWRRHT
VVVQSPLTDLNFNEWKELDGGGPPESAGVRPHSDNKDSGLSSLESTKARASSAASLPSGD
LGALQGLPARRSAAARLHQCL
Download sequence
Identical sequences ENSRNOP00000032436 10116.ENSRNOP00000052281

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]