SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSRNOP00000032508 from Rattus norvegicus 69_3.4

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSRNOP00000032508
Domain Number 1 Region: 321-450
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 3.27e-43
Family Regulator of G-protein signaling, RGS 0.0000224
Further Details:      
 
Domain Number 2 Region: 18-121
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.36e-32
Family DEP domain 0.014
Further Details:      
 
Domain Number 3 Region: 248-310
Classification Level Classification E-value
Superfamily Transducin (heterotrimeric G protein), gamma chain 9.42e-18
Family Transducin (heterotrimeric G protein), gamma chain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSRNOP00000032508   Gene: ENSRNOG00000021984   Transcript: ENSRNOT00000031449
Sequence length 477
Comment pep:known chromosome:RGSC3.4:13:90740218:90933661:-1 gene:ENSRNOG00000021984 transcript:ENSRNOT00000031449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQGNNYGQTSNGVAEESPNMLVYRKMEDVIARMQDEKNGIPIRTVKSFLSKIPSVFSGS
DIVQWLIKNLTIEDPVEALHLGTLMAAHGYFFPISDHVLTLKDDGTFYRFQTPYFWPSNC
WEPENTDYAVYLCKRTMQNKARLELADYEAESLARLQRAFARKWEFIFMQAEAQAKVDKK
RDKIERKILDSQERAFWDVHRPVPGCVNTTEVDIKKSSRMRNPHKTRKSVYGLQNDIRSH
SPTHTPTPETKPPTEDELHRQIKYWQIQLDRHRLKMSKVADSLLSYTEQYVEYDPFLVPP
DPSNPWLSDDTTFWELEASKEPSQQRVKRWGFGMDEALKDPVGREQFLKFLESEFSSENL
RFWLAVEDLKKRPIREVPSRVQEIWQEFLAPGAPSAINLDSKSYDKTTQNVKEPGRYTFE
DAQEHIYKLMKSDSYPRFIRSSAYQELLQAKRKGRNIPIFPCHKNCTPTLRASTNLL
Download sequence
Identical sequences P49803
10116.ENSRNOP00000046013 ENSRNOP00000032508 NP_062216.1.100692 NP_062216.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]